7YKF: MAGI2 PDZ0-GK/pEphexin4 complex

Crystal structure of MAGI2 PDZ0-GK/pEphexin4 complex. Determined by X-ray diffraction at 2.28 Å resolution. Released 2 Aug 2023.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Mus musculus
Chains: 4
Atoms: 3,021
Mol. weight: 55.03 kDa
Released: 2 Aug 2023

Explore 7YKF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YKF contains 25 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	23-25	3	1
α-helix	27-29	3
β-strand	31	1	2
β-strand	33-35	3	1
β-strand	44-48	5	1
α-helix	55	1
β-strand	56-60	5	1
β-strand	63-64	2	1
α-helix	70-78	9
α-helix	81	1
β-strand	84-89	6	1
β-strand	92	1	3
β-strand	95	1	3
β-strand	98	1	2
α-helix	99-104	6
α-helix	107-108	2
α-helix	112-126	15
β-strand	131-132	2	4
α-helix	135-137	3
β-strand	142	1	5
β-strand	146	1	5
β-strand	147-148	2	4
α-helix	151-159	9
β-strand	163-169	7	4
β-strand	172-177	6	4
α-helix	178-181	4

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	232-234	3
α-helix	235-240	6

Chain C: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	6
β-strand	23-25	3	6
α-helix	27-29	3
β-strand	31	1	7
β-strand	33-35	3	6
β-strand	44-48	5	6
α-helix	49-51	3
α-helix	55	1
β-strand	56-60	5	6
β-strand	63-64	2	6
α-helix	70-78	9
α-helix	81	1
β-strand	84-89	6	6
β-strand	92	1	8
β-strand	95	1	8
β-strand	98	1	7
α-helix	99-104	6
α-helix	107-108	2
α-helix	112-126	15
β-strand	131-132	2	9
α-helix	135-137	3
β-strand	142	1	10
β-strand	146	1	10
β-strand	147-148	2	9
α-helix	151-159	9
β-strand	163-169	7	9
β-strand	172-177	6	9
α-helix	178-181	4

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	232-234	3
α-helix	235-241	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2	A, C	protein	234	Mus musculus	Q9WVQ1 (AlphaFold model)
Ephexin4	B, D	protein	12	Mus musculus	Q3U5C8 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7YKF_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (chains A, C)
GPGSSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEE
LLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHE
LQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYEDNYYG
TPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEER

Sequence of entity 2 (B, D), FASTA

>7YKF_2 Ephexin4 (chains B, D)
NLRNQSYRAAMK

Primary citation

Phosphorylation-dependent recognition of diverse protein targets by the cryptic GK domain of MAGI MAGUKs. Zhang, M., Cao, A., Lin, L. et al. Sci Adv (2023) 9:eadf3295-eadf3295. DOI 10.1126/sciadv.adf3295 · PubMed

Other PDB entries of the same protein (UniProt Q9WVQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJZ 1.65 Å, Crystal Structure of MAGI2 and Dendrin complex
7YKI 2.0 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR3 peptide
6KKG 2.15 Å, Crystal structure of MAGI2-Dendrin complex
7YKG 2.16 Å, Crystal structure of MAGI2 PDZ0-GK/pSGEF complex
7YKH 2.5 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR2 peptide
7D6F 3.0 Å, The crystal structure of ARMS-PBM/MAGI2-PDZ4

Browse structure collections

About this viewer

MolViewer shows 7YKF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.