7CTE: Human Origin Recognition Complex, ORC2-5

Human Origin Recognition Complex, ORC2-5. Determined by electron microscopy at 3.8 Å resolution. Released 6 Jan 2021.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 13,699
Mol. weight: 250.24 kDa
Ligands: ATP
Released: 6 Jan 2021

Explore 7CTE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7CTE contains 94 α-helices and 42 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	270-273	4
α-helix	285-292	8
α-helix	294-297	4
α-helix	298-306	9
β-strand	309-314	6	1
α-helix	320-330	11
β-strand	335	1	2
β-strand	336-337	2	3
β-strand	338-339	2	4
α-helix	348-358	11
α-helix	369-382	14
β-strand	388	1	2
β-strand	391-392	2	4
α-helix	406-413	8
β-strand	421	1	1
β-strand	424	1	1
α-helix	429-431	3
α-helix	435-438	4
β-strand	442-447	6	1
α-helix	455-460	6
α-helix	474-482	9
α-helix	486-500	15
β-strand	511	1	5
α-helix	513-521	9
α-helix	529-540	12
β-strand	546-549	4	5
β-strand	555-558	4	5
α-helix	567-572	6

Chain C: 34 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	11	1
β-strand	12-13	2	3
α-helix	14	1
α-helix	40-63	24
α-helix	67-82	16
β-strand	101-102	2	6
β-strand	105-106	2	7
α-helix	114-128	15
β-strand	133-136	4	8
α-helix	144-162	19
α-helix	197-206	10
α-helix	213-214	2
β-strand	215	1	9
β-strand	216-219	4	8
α-helix	227-239	13
β-strand	246	1	9
β-strand	251-252	2	7
α-helix	257-262	6
α-helix	265-269	5
β-strand	272-273	2	6
β-strand	276	1	7
α-helix	282-292	11
α-helix	304-313	10
α-helix	314-318	5
α-helix	322-338	17
α-helix	348-354	7
α-helix	360-368	9
α-helix	370-377	8
α-helix	381-387	7
α-helix	391-424	34
α-helix	435-441	7
α-helix	451-459	9
α-helix	466-481	16
α-helix	483-486	4
α-helix	493-500	8
α-helix	549-559	11
α-helix	560-564	5
α-helix	565	1
α-helix	570-573	4
α-helix	585-592	8
α-helix	596-605	10
α-helix	630-637	8
β-strand	644	1	10
α-helix	646-662	17
α-helix	670-690	21
β-strand	695-696	2	10
β-strand	704-705	2	10

Chain D: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	15-29	15
α-helix	41-56	16
β-strand	64-65	2	11
α-helix	73-86	14
β-strand	95-100	6	11
α-helix	107-117	11
α-helix	120-122	3
α-helix	132-145	14
β-strand	154-159	6	11
α-helix	161-164	4
α-helix	171-182	12
β-strand	189-192	4	11
α-helix	198-201	4
α-helix	204-209	6
α-helix	214	1
β-strand	215	1	11
α-helix	216	1
α-helix	223-234	12
α-helix	243-258	16
α-helix	260-272	13
α-helix	278-288	11
α-helix	299-308	10
α-helix	315-319	5
α-helix	323-336	14
β-strand	344	1	12
α-helix	346-359	14
α-helix	369-379	11
β-strand	385-387	3	12
β-strand	402-404	3	12
α-helix	408-414	7
α-helix	423-431	9

Chain E: 21 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	32-36	5	13
α-helix	45-54	10
β-strand	58-62	5	14
α-helix	69-80	12
α-helix	99-109	11
β-strand	120-125	6	14
α-helix	128-131	4
α-helix	137-142	6
α-helix	144-147	4
β-strand	152-153	2	14
β-strand	154-155	2	13
β-strand	156	1	14
α-helix	162-165	4
α-helix	173-174	2
β-strand	175-178	4	13
α-helix	179-182	4
α-helix	184-190	7
α-helix	201-215	15
α-helix	222-243	22
α-helix	250-267	18
α-helix	304-315	12
α-helix	324-327	4
α-helix	354-356	3
α-helix	359-369	11
α-helix	378-389	12
β-strand	393-395	3	15
β-strand	407-409	3	15
α-helix	413-421	9
α-helix	428-431	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Origin recognition complex subunit 2	B	protein	577	Homo sapiens	Q13416 (AlphaFold model)
Origin recognition complex subunit 3	C	protein	711	Homo sapiens	Q9UBD5 (AlphaFold model)
Origin recognition complex subunit 4	D	protein	436	Homo sapiens	O43929 (AlphaFold model)
Origin recognition complex subunit 5	E	protein	435	Homo sapiens	O43913 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7CTE_1 Origin recognition complex subunit 2 (chains B)
MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKIIKKPEYDLEED
DQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNRKHSEKMAKLASELAKTPQKS
VSFSLKNDPEITINVPQSSKGHSASDKVQPKNNDKSEFLSTAPRSLRKRLIVPRSHSDSE
SEYSASNSEDDEGVAQEHEEDTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLV
EEYFEAHSSSKVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK
WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKSVLNSITEEVL
DHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQMLRGEKSQQIIGQLSSLHNIYL
IASIDHLNAPLMWDHAKQSLFNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLTHV
LRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFR
DHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA

Sequence of entity 2 (C), FASTA

>7CTE_2 Origin recognition complex subunit 3 (chains C)
MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLIWQQMKSENER
LQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREIPTAALVLGVNVTDHDLTFGS
LTEALQNNVTPYVVSLQAKDCPDMKHFLQKLISQLMDCCVDIKSKEEESVHVTQRKTHYS
MDSLSSWYMTVTQKTDPKMLSKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQH
LHEFPLILIFGIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF
KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPEAKRRINFLSN
NQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQLLLENLHVYHMNYFLVLRCLH
KFTSSLPKYPLGRQIRELYCTCLEKNIWDSEEYASVLQLLRMLAKDELMTILEKCFKVFK
SYCENHLGSTAKRIEEFLAQFQSLDETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELR
RSKKQTKFEVLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIALH
TALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEAFATVVTAAE
KMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC

Sequence of entity 3 (D), FASTA

>7CTE_3 Origin recognition complex subunit 4 (chains D)
MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGES
NSVLIIGPRGSGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNL
ENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDIS
QSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFGFPQYVKIFKEQLSLPAEF
PDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLHMLLMLALNRVTASHPFMTAV
DLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRK
AHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSEREYQLMKLLLDNTQIMNALQKYPN
CPTDVRQWATSSLSWL

Sequence of entity 4 (E), FASTA

>7CTE_4 Origin recognition complex subunit 5 (chains E)
MPHLENVVLCRESQVSILQSLFGERHHFSFPSIFIYGHTASGKTYVTQTLLKTLELPHVF
VNCVECFTLRLLLEQILNKLNHLSSSEDGCSTEITCETFNDFVRLFKQVTTAENLKDQTV
YIVLDKAEYLRDMEANLLPGFLRLQELADRNVTVLFLSEIVWEKFRPNTGCFEPFVLYFP
DYSIGNLQKILSHDHPPEYSADFYAAYINILLGVFYTVCRDLKELRHLAVLNFPKYCEPV
VKGEASERDTRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGLSAHTHV
ELPYYSKFILIAAYLASYNPARTDKRFFLKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLD
RLLAILYSIVDSRVAPTANIFSQITSLVTLQLLTLVGHDDQLDGPKYKCTVSLDFIRAIA
RTVNFDIIKYLYDFL

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Structural insight into the assembly and conformational activation of human origin recognition complex. Cheng, J., Li, N., Wang, X. et al. Cell Discov (2020) 6:88-88. DOI 10.1038/s41421-020-00232-3 · PubMed

Other PDB entries of the same protein (UniProt Q13416 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C8H 2.01 Å, Crystal structure of ORC2 C-terminal domain
11RL 2.8 Å, CryoEM structure of the human origin recognition complex with DNA and CDC6 protein
7JPO 3.2 Å, ORC-O1AAA: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC2 WH
7JPQ 3.5 Å, ORC-O2-5: Human Origin Recognition Complex (ORC) with subunits 2,3,4,5
8S0D 3.6 Å, H. sapiens MCM bound to double stranded DNA and ORC1-6
7JPP 3.7 Å, ORC-O2WH: Human Origin Recognition Complex (ORC) with dynamic/unresolved ORC1 AAA+ domain
8S0E 3.8 Å, H. sapiens OCCM bound to double stranded DNA
7JPR 4.0 Å, ORC-OPEN: Human Origin Recognition Complex (ORC) in an open conformation
8S0C 4.0 Å, H. sapiens ORC1-5 bound to double stranded DNA as part of the MCM-ORC complex
8S0F 4.1 Å, H. sapiens OC1M bound to double stranded DNA
7JPS 4.4 Å, ORC-DNA: Human Origin Recognition Complex (ORC) with DNA bound in the core
7CTF 4.8 Å, Human origin recognition complex 1-5 State II

Browse structure collections

About this viewer

MolViewer shows 7CTE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.