7D19: Mouse Cryptochrome 1

Crystal structure of mouse Cryptochrome 1 in complex with compound TH129. Determined by X-ray diffraction at 2.35 Å resolution. Released 27 Jan 2021.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,539
Mol. weight: 115.65 kDa
Ligands: GOC
Released: 27 Jan 2021

Explore 7D19 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D19 contains 60 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	1
α-helix	19-25	7
β-strand	30-37	8	1
α-helix	39-41	3
β-strand	44	1	2
α-helix	46-48	3
α-helix	49-67	19
β-strand	73-77	5	1
α-helix	80-91	12
β-strand	95-99	5	1
α-helix	104-120	17
β-strand	123-127	5	1
α-helix	135-141	7
α-helix	150-159	10
α-helix	164-170	7
α-helix	172-175	4
β-strand	179	1	1
α-helix	186-190	5
α-helix	191-194	4
α-helix	196-198	3
α-helix	214-231	18
α-helix	246-247	2
α-helix	252-257	6
α-helix	262-277	16
α-helix	284-287	4
α-helix	290-300	11
β-strand	315	1	3
β-strand	321	1	4
α-helix	324-331	8
α-helix	338-350	13
α-helix	355-363	9
α-helix	364-368	5
β-strand	372	1	4
α-helix	374-384	11
α-helix	390-400	11
β-strand	404	1	3
α-helix	417-422	6
α-helix	427-432	6
α-helix	434-436	3
α-helix	452-458	7
β-strand	462	1	5
β-strand	466	1	5
α-helix	473-491	19

Chain B: 30 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	6
α-helix	19-25	7
β-strand	30-37	8	6
α-helix	46-48	3
α-helix	49-67	19
β-strand	73-77	5	6
α-helix	80-91	12
β-strand	95-99	5	6
α-helix	104-120	17
β-strand	123-127	5	6
α-helix	135-141	7
α-helix	150-159	10
α-helix	161-170	10
α-helix	172-175	4
β-strand	179	1	6
α-helix	186-190	5
α-helix	191-194	4
α-helix	214-231	18
α-helix	246-247	2
α-helix	252-257	6
α-helix	262-277	16
α-helix	284-287	4
α-helix	290-300	11
β-strand	315	1	7
β-strand	321	1	8
α-helix	324-331	8
α-helix	338-350	13
α-helix	355-363	9
α-helix	364-368	5
β-strand	372	1	8
α-helix	374-384	11
α-helix	390-400	11
β-strand	404	1	7
β-strand	411	1	2
α-helix	417-422	6
α-helix	427-432	6
α-helix	434-436	3
α-helix	447-449	3
α-helix	452-458	7
β-strand	462	1	9
β-strand	466	1	9
α-helix	467-469	3
α-helix	473-488	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cryptochrome-1	A, B	protein	498	Mus musculus	P97784 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7D19_1 Cryptochrome-1 (chains A, B)
GTMGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQC
LEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLAT
EAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKC
MTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPR
MNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYT
AATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLAR
HAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGF
GRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASR
LNIERMKQIYQQLSRYRG

Ligands and cofactors

ID	Name	Formula	Copies
GOC	N-[2-(2,4-dimethylphenyl)-4,6-dihydrothieno[3,4-c]pyrazol-3-yl]-4-(phenylcarbon…	C27 H23 N3 O2 S	2

Primary citation

Photopharmacological Manipulation of Mammalian CRY1 for Regulation of the Circadian Clock. Kolarski, D., Miller, S., Oshima, T. et al. J Am Chem Soc (2021) 143:2078-2087. DOI 10.1021/jacs.0c12280 · PubMed

Other PDB entries of the same protein (UniProt P97784 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5T5X 1.84 Å, High resolution structure of mouse Cryptochrome 1
7D1C 1.91 Å, Crystal structure of mouse Cryptochrome 1 in complex with compound TH303
7D0M 1.95 Å, Crystal structure of mouse CRY1 with bound cryoprotectant
6KX4 2.0 Å, Crystal structure of mouse Cryptochrome 1 apo form
6KX5 2.0 Å, Crystal structure of mouse Cryptochrome 1 in complex with KL044 compound
6KX6 2.0 Å, Crystal structure of mouse Cryptochrome 1 in complex with KL101 compound
7WVA 2.05 Å, Crystal structure of mouse Cryptochrome 1 in complex with TH401 compound
6KX7 2.1 Å, Crystal structure of mouse Cryptochrome 1 in complex with TH301 compound
6LUE 2.1 Å, Crystal structure of mouse Cryptochrome 1 in complex with compound KL201
7DLI 2.2 Å, Crystal structure of mouse CRY1 in complex with KL001 compound
4CT0 2.45 Å, Crystal Structure of Mouse Cryptochrome1 in Complex with Period2
4K0R 2.65 Å, Crystal structure of mouse Cryptochrome 1

Browse structure collections

About this viewer

MolViewer shows 7D19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.