Crystal structure of mouse Cryptochrome 1 in complex with TH401 compound. Determined by X-ray diffraction at 2.05 Å resolution. Released 7 Sept 2022.
Explore 7WVA in 3D Show helices and sheets RCSB PDB PDBe
7WVA contains 33 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 19-25 | 7 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 49-67 | 19 | |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 80-91 | 12 | |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 104-119 | 16 | |
| β-strand | 123-127 | 5 | 1 |
| α-helix | 135-141 | 7 | |
| α-helix | 150-158 | 9 | |
| α-helix | 161-170 | 10 | |
| α-helix | 172-175 | 4 | |
| β-strand | 179 | 1 | 1 |
| α-helix | 186-190 | 5 | |
| α-helix | 191-194 | 4 | |
| α-helix | 214-229 | 16 | |
| α-helix | 236-239 | 4 | |
| α-helix | 242-244 | 3 | |
| α-helix | 246-247 | 2 | |
| α-helix | 252-257 | 6 | |
| α-helix | 262-277 | 16 | |
| α-helix | 284-287 | 4 | |
| α-helix | 288-301 | 14 | |
| β-strand | 321 | 1 | 2 |
| α-helix | 324-331 | 8 | |
| α-helix | 338-350 | 13 | |
| α-helix | 355-363 | 9 | |
| α-helix | 364-368 | 5 | |
| β-strand | 372 | 1 | 2 |
| α-helix | 374-384 | 11 | |
| α-helix | 390-400 | 11 | |
| α-helix | 417-422 | 6 | |
| α-helix | 427-432 | 6 | |
| α-helix | 434-436 | 3 | |
| α-helix | 441-444 | 4 | |
| α-helix | 447-449 | 3 | |
| α-helix | 452-457 | 6 | |
| β-strand | 462 | 1 | 3 |
| β-strand | 466 | 1 | 3 |
| α-helix | 467-469 | 3 | |
| α-helix | 473-489 | 17 | |
| α-helix | 491-493 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cryptochrome-1 | A | protein | 498 | Mus musculus | P97784 (AlphaFold model) |
>7WVA_1 Cryptochrome-1 (chains A) GTMGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQC LEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLAT EAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKC MTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPR MNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYT AATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLAR HAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGF GRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASR LNIERMKQIYQQLSRYRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 6I3 | 2-(1-methylbenzimidazol-2-yl)sulfanyl-N-[(E)-(2,3,4-trimethoxyphenyl)methyliden… | C20 H22 N4 O4 S | 1 |
A methylbenzimidazole derivative regulates mammalian circadian rhythms by targeting Cryptochrome proteins. Yagi, M., Miller, S., Nagai, Y. et al. F1000Res (2022) 11:1016-1016. DOI 10.12688/f1000research.124658.1 · PubMed
Other PDB entries of the same protein (UniProt P97784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7WVA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.