7DF7: Human V-1 in the apo form

Crystal structure of human V-1 in the apo form. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Jan 2021.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,830
Mol. weight: 26.65 kDa
Released: 20 Jan 2021

Explore 7DF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DF7 contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-12	10
α-helix	15-23	9
α-helix	38-44	7
α-helix	48-56	9
α-helix	71-77	7
α-helix	81-89	9
α-helix	104-107	4
α-helix	111-116	6

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1-12	12
α-helix	15-23	9
α-helix	38-44	7
α-helix	48-56	9
α-helix	71-77	7
α-helix	81-88	8
α-helix	111-116	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myotrophin	A, B	protein	123	Homo sapiens	P58546 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7DF7_1 Myotrophin (chains A, B)
GPLGSMCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLL
LKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKA
LLQ

Primary citation

Crystal structure of human V-1 in the apo form. Takeda, S., Koike, R., Nagae, T. et al. Acta Crystallogr F Struct Biol Commun (2021) 77:13-21. DOI 10.1107/S2053230X20016829 · PubMed

Other PDB entries of the same protein (UniProt P58546 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AAA 2.2 Å, Crystal Structure of Actin capping protein in complex with V-1
7DSB 2.44 Å, Crystal structure of actin capping protein in complex with V-1 and twinfilin C-terminal…
7DSA 2.8 Å, Crystal structure of actin capping protein in complex with V-1 (space group P62)

Browse structure collections

About this viewer

MolViewer shows 7DF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.