7DF9: Crystal of Arrestin2-V2Rpp-1-Fab30 complex

Crystal of Arrestin2-V2Rpp-1-Fab30 complex. Determined by X-ray diffraction at 3.17 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 3.17 Å
Organisms: Bos taurus, synthetic construct, Mus musculus
Chains: 4
Atoms: 5,747
Mol. weight: 102.85 kDa
Released: 28 Jul 2021

Explore 7DF9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DF9 contains 22 α-helices and 79 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26-28	3	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37-43	7	1
α-helix	45-47	3
β-strand	53-64	12	4
β-strand	74-87	14	4
α-helix	99-108	10
α-helix	109-111	3
β-strand	112-117	6	1
β-strand	127-129	3	4
α-helix	130-132	3
β-strand	140-148	9	4
β-strand	164-168	5	4
β-strand	169-171	3	2
α-helix	178-182	5
β-strand	183-188	6	5
β-strand	197-203	7	5
β-strand	207-208	2	6
α-helix	212-213	2
β-strand	214-222	9	5
β-strand	228-230	3	7
β-strand	233-242	10	8
β-strand	246	1	8
β-strand	249-255	7	8
β-strand	262	1	7
β-strand	266	1	5
β-strand	269-274	6	5
α-helix	287	1
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	302-304	3
β-strand	316-327	12	8
β-strand	328-329	2	7
α-helix	333-338	6
β-strand	343-349	7	8
β-strand	350-351	2	6
α-helix	353-356	4

Chain H: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	15
β-strand	22	1	16
β-strand	26	1	17
β-strand	33-36	4	16
β-strand	40	1	15
β-strand	49-53	5	18
β-strand	62-67	6	18
β-strand	72-75	4	18
α-helix	77-79	3
β-strand	83-86	4	16
β-strand	95-98	4	16
β-strand	108-112	5	18
β-strand	125	1	18
β-strand	129-130	2	18
β-strand	132	1	17
α-helix	140-141	2
β-strand	142-146	5	19
β-strand	153-154	2	19
β-strand	157-167	11	19
β-strand	173-175	3	20
β-strand	187	1	21
α-helix	188-190	3
β-strand	191-192	2	19
β-strand	198-200	3	19
β-strand	202	1	21
β-strand	203-207	5	19
β-strand	217-222	6	20
α-helix	223-225	3
β-strand	227-232	6	20

Chain L: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	18-19	2	9
β-strand	23-26	4	10
β-strand	32-37	6	9
β-strand	46-51	6	10
β-strand	53	1	11
β-strand	55	1	11
α-helix	57	1
β-strand	58-61	4	10
α-helix	66	1
β-strand	67	1	10
α-helix	68	1
β-strand	75-79	5	9
β-strand	83-88	6	9
β-strand	98-103	6	10
α-helix	109	1
β-strand	110	1	10
β-strand	116-119	4	10
β-strand	129-130	2	12
α-helix	132-134	3
α-helix	135-140	6
β-strand	142-148	7	12
β-strand	150-152	3	13
β-strand	159-163	5	14
β-strand	167	1	14
β-strand	172-174	3	12
β-strand	186-187	2	13
β-strand	190-195	6	12
α-helix	196-199	4
β-strand	205-209	5	14
α-helix	217-218	2
β-strand	219-221	3	14

Chain V: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	361-364	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	426	Bos taurus	P17870 (AlphaFold model)
Vasopressin V2 receptor phosphopeptide	V	protein	23	synthetic construct	P30518 (AlphaFold model)
FAB30 light chain	L	protein	227	Mus musculus
FAB30 heavy chain	H	protein	249	Mus musculus

Sequence of entity 1 (A), FASTA

>7DF9_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPRLNDRLE
HHHHHH

Sequence of entity 2 (V), FASTA

>7DF9_2 VASOPRESSIN V2 RECEPTOR PHOSPHOPEPTIDE (chains V)
RTPPSLGPQDESCTTASSSLRKD

Sequence of entity 3 (L), FASTA

>7DF9_3 FAB30 LIGHT CHAIN (chains L)
MFVFSIATNAYASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLL
IYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIK
RTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (H), FASTA

>7DF9_4 FAB30 HEAVY CHAIN (chains H)
MFVFSIATNAYAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGL
EWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYS
GLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK
THHHHHHHH

Primary citation

Structural studies of phosphorylation-dependent interactions between the V2R receptor and arrestin-2. He, Q.T., Xiao, P., Huang, S.M. et al. Nat Commun (2021) 12:2396-2396. DOI 10.1038/s41467-021-22731-x · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 7DF9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.