7DFB: Crystal of Arrestin2-V2Rpp-6-7-Fab30 complex

Crystal of Arrestin2-V2Rpp-6-7-Fab30 complex. Determined by X-ray diffraction at 3.28 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 3.28 Å
Organisms: Bos taurus, synthetic construct, Mus musculus
Chains: 4
Atoms: 5,913
Mol. weight: 102.77 kDa
Released: 28 Jul 2021

Explore 7DFB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DFB contains 20 α-helices and 68 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	18-22	5	1
β-strand	26	1	2
β-strand	29	1	3
β-strand	34	1	3
α-helix	35-36	2
β-strand	37-43	7	1
α-helix	45-47	3
β-strand	53-63	11	4
β-strand	74-85	12	4
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	124-126	3
β-strand	127-129	3	4
α-helix	130-132	3
α-helix	139-140	2
β-strand	141-150	10	4
β-strand	163-168	6	4
β-strand	169	1	2
α-helix	180-182	3
β-strand	183-188	6	5
α-helix	196	1
β-strand	197-203	7	5
β-strand	207-209	3	6
β-strand	214-222	9	5
β-strand	228-242	15	7
β-strand	247-258	12	7
β-strand	262	1	7
β-strand	266-274	9	5
α-helix	279-281	3
β-strand	288-290	3	4
β-strand	300	1	4
α-helix	301-303	3
β-strand	316-329	14	7
β-strand	343-349	7	7
β-strand	350-352	3	6

Chain H: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	20-22	3	12
β-strand	26-27	2	13
β-strand	33-38	6	12
β-strand	47-54	8	14
β-strand	61-66	6	14
β-strand	73-75	3	14
α-helix	77-82	6
β-strand	83-88	6	12
β-strand	93-98	6	12
β-strand	107-115	9	14
β-strand	125	1	14
β-strand	129-131	3	14
β-strand	132-133	2	13
α-helix	140-141	2
β-strand	142-146	5	15
β-strand	154	1	15
β-strand	157-167	11	15
β-strand	174-176	3	16
β-strand	185-187	3	15
α-helix	188-190	3
β-strand	191-192	2	15
β-strand	198-207	10	15
β-strand	217-222	6	16
α-helix	223-225	3
β-strand	227-232	6	16

Chain L: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	17-19	3	8
β-strand	23-24	2	9
β-strand	32-38	7	8
β-strand	46-51	6	9
α-helix	56-57	2
β-strand	58-62	5	9
β-strand	66-67	2	9
α-helix	68	1
β-strand	75-80	6	8
β-strand	83-88	6	8
β-strand	98-103	6	9
β-strand	111	1	9
β-strand	115-117	3	9
α-helix	124-126	3
β-strand	129	1	10
α-helix	132-134	3
β-strand	142-150	9	10
β-strand	159-163	5	11
β-strand	167	1	11
β-strand	172-176	5	10
α-helix	178-180	3
β-strand	187-195	9	10
α-helix	196-199	4
β-strand	205-209	5	11
β-strand	218-222	5	11

Chain V: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	4
β-strand	361-364	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	426	Bos taurus	P17870 (AlphaFold model)
V2Rpp-6-7	V	protein	23	synthetic construct	P30518 (AlphaFold model)
FAB30 light chain	L	protein	227	Mus musculus
FAB30 heavy chain	H	protein	249	Mus musculus

Sequence of entity 1 (A), FASTA

>7DFB_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPRLNDRLE
HHHHHH

Sequence of entity 2 (V), FASTA

>7DFB_2 V2Rpp-6-7 (chains V)
RTPPSLGPQDESCTTASSSLRKD

Sequence of entity 3 (L), FASTA

>7DFB_3 FAB30 LIGHT CHAIN (chains L)
MFVFSIATNAYASDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLL
IYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIK
RTVAAPSVFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (H), FASTA

>7DFB_4 FAB30 HEAVY CHAIN (chains H)
MFVFSIATNAYAEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGL
EWVASISSYYGYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYS
GLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGA
LTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK
THHHHHHHH

Primary citation

Structural studies of phosphorylation-dependent interactions between the V2R receptor and arrestin-2. He, Q.T., Xiao, P., Huang, S.M. et al. Nat Commun (2021) 12:2396-2396. DOI 10.1038/s41467-021-22731-x · PubMed

Other PDB entries of the same protein (UniProt P17870 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1G4M 1.9 Å, Crystal structure of bovine beta-arrestin 1
1G4R 2.2 Å, Crystal structure of bovine beta-arrestin 1
3GC3 2.2 Å, Crystal Structure of Arrestin2S and Clathrin
7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex
22GK 2.84 Å, C5a bound C5aR2 in complex with beta-arrestin1
1JSY 2.9 Å, Crystal structure of bovine arrestin-2
1ZSH 2.9 Å, Crystal structure of bovine arrestin-2 in complex with inositol hexakisphosphate (IP6)
22CR 2.9 Å, C5a-desArg bound C5aR2 in complex with beta-arrestin1

Browse structure collections

About this viewer

MolViewer shows 7DFB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.