7DKL: Tandem DEP domains of DEPTOR

Crystal structure of the tandem DEP domains of DEPTOR. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Dec 2021.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,854
Mol. weight: 26.06 kDa
Released: 8 Dec 2021

Explore 7DKL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DKL contains 8 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	22-46	25
β-strand	51-55	5	1
β-strand	58-63	6	1
β-strand	64-65	2	2
α-helix	66-75	10
α-helix	82-94	13
β-strand	98-100	3	2
β-strand	114-117	4	2
α-helix	118-121	4
α-helix	128-143	16
β-strand	152-156	5	3
β-strand	159-166	8	3
α-helix	167-177	11
α-helix	183-195	13
β-strand	199-201	3	3
β-strand	214-217	4	3
α-helix	227-231	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DEP domain-containing mTOR-interacting protein	A	protein	216	Homo sapiens	Q8TB45 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7DKL_1 DEP domain-containing mTOR-interacting protein (chains A)
SGAQQRELERMAEVLVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEA
SDRETAIKLMQKLADRGIIHHVCDEHKEFKDVKLFYRFRKDDGTFPLDNEVKAFMRGQRL
YEKLMSPENTLLQPREEEGVKYERTFMASEFLDWLVQEGEATTRKEAEQLCHRLMEHGII
QHVSSKHPFVDSNLLYQFRMNFRRRRRLMELLNEKS

Primary citation

Structural Basis of DEPTOR to Recognize Phosphatidic Acid Using its Tandem DEP Domains. Weng, Z., Shen, X., Zheng, J. et al. J Mol Biol (2021) 433:166989-166989. DOI 10.1016/j.jmb.2021.166989 · PubMed

Other PDB entries of the same protein (UniProt Q8TB45 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PED 1.93 Å, DEPTOR DEP domain tandem (DEPt)
7PE8 3.2 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, focussed on one protomer
7PE7 3.41 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, overall refinement
7PEB 3.67 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, focussed on one protomer
7PE9 3.7 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 2, DEPt-bound subset local…
7PEA 4.07 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, overall refinement
7PEC 4.24 Å, cryo-EM structure of DEPTOR bound to human mTOR complex 1, DEPt-bound subset local…
7OWG 4.7 Å, human DEPTOR in a complex with mutant human mTORC1 A1459P

Browse structure collections

About this viewer

MolViewer shows 7DKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.