7DSQ: Overall structure of the LAT1-4F2hc

Overall structure of the LAT1-4F2hc bound with 3,5-diiodo-L-tyrosine. Determined by electron microscopy at 3.4 Å resolution. Released 10 Mar 2021.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,507
Mol. weight: 131.16 kDa
Ligands: TYI, Y01, 3PH
Released: 10 Mar 2021

Explore 7DSQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DSQ contains 48 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	167-173	7
α-helix	180-206	27
α-helix	219-221	3
β-strand	225-227	3	1
α-helix	232-235	4
α-helix	242-246	5
α-helix	249-255	7
β-strand	259-262	4	1
α-helix	263-264	2
β-strand	266-268	3	2
α-helix	273-275	3
β-strand	276-281	6	2
α-helix	288-300	13
β-strand	304-308	5	1
α-helix	325-341	17
β-strand	346-349	4	1
α-helix	351-353	3
α-helix	357-369	13
β-strand	377-380	4	1
α-helix	386-392	7
β-strand	400-402	3	1
α-helix	414-427	14
β-strand	432-434	3	3
α-helix	442-444	3
α-helix	448-450	3
α-helix	451-458	8
β-strand	463-465	3	3
β-strand	466-468	3	1
α-helix	488-490	3
α-helix	510-513	4
α-helix	521-531	11
α-helix	535-539	5
β-strand	541-545	5	4
β-strand	551-557	7	4
α-helix	562	1
β-strand	563-569	7	4
β-strand	575-576	2	5
β-strand	593-594	2	6
β-strand	599	1	4
β-strand	610-611	2	6
β-strand	616-617	2	5
β-strand	622-627	6	4

Chain B: 26 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	50	1	7
α-helix	53-63	11
α-helix	72-77	6
α-helix	82-109	28
α-helix	118-124	7
α-helix	127-135	9
α-helix	136-140	5
α-helix	141-144	4
α-helix	146-156	11
α-helix	158-160	3
α-helix	165-167	3
α-helix	168-188	21
α-helix	191-218	28
α-helix	243-252	10
β-strand	267	1	7
α-helix	270-296	27
α-helix	302-306	5
α-helix	311-319	9
α-helix	326-355	30
α-helix	366	1
β-strand	367	1	8
β-strand	372	1	8
α-helix	374-385	12
α-helix	386-388	3
α-helix	394-396	3
α-helix	397-421	25
α-helix	435-451	17
α-helix	455-466	12
α-helix	469-475	7
α-helix	483-500	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	647	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 1	B	protein	527	Homo sapiens	Q01650 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7DSQ_1 4F2 cell-surface antigen heavy chain (chains A)
MAHHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQ
AGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQD
TEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLS
KEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALY
RIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFG
SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF
QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL
SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV
FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRR
LSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPA
SASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAALE

Sequence of entity 2 (B), FASTA

>7DSQ_2 Large neutral amino acids transporter small subunit 1 (chains B)
MADYKDDDDKSGPDEVDASGRAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGE
GEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGA
LCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPL
FPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIG
KGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVN
GSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFF
SFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGI
GFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

Ligands and cofactors

ID	Name	Formula	Copies
TYI	3,5-diiodotyrosine	C9 H9 I2 N O3	1
Y01	Cholesterol hemisuccinate	C31 H50 O4	2
3PH	1,2-diacyl-glycerol-3-sn-phosphate	C39 H77 O8 P	1

Primary citation

Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter. Yan, R., Li, Y., Muller, J. et al. Cell Discov (2021) 7:16-16. DOI 10.1038/s41421-021-00247-4 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 7DSQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.