7DSW: Human NHE1-CHP1 complex under pH 7.5

Structure of a human NHE1-CHP1 complex under pH 7.5. Determined by electron microscopy at 3.3 Å resolution. Released 23 Jun 2021.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,720
Mol. weight: 102.34 kDa
Ligands: LBN
Released: 23 Jun 2021

Explore 7DSW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DSW contains 46 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 23 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	101-120	20
α-helix	131-149	19
α-helix	152-154	3
α-helix	160	1
α-helix	161-165	5
α-helix	166-175	10
α-helix	183-185	3
α-helix	186-190	5
α-helix	191-196	6
α-helix	197-214	18
α-helix	225-234	10
β-strand	237	1	2
α-helix	239-245	7
α-helix	253-280	28
α-helix	288-320	33
α-helix	330-347	18
α-helix	352-366	15
α-helix	373-403	31
α-helix	411-436	26
α-helix	443-445	3
α-helix	446-453	8
β-strand	458	1	2
α-helix	462-467	6
α-helix	477-493	17
α-helix	500-504	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/hydrogen exchanger 1	A, B	protein	420	Homo sapiens	P19634 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7DSW_1 Sodium/hydrogen exchanger 1 (chains A, B)
KAFPVLGIDYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLI
KGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGG
LMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLN
DAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHI
RVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMW
SSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRIVKLTP
KDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLL

Ligands and cofactors

ID	Name	Formula	Copies
LBN	1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine	C42 H82 N O8 P	12

Primary citation

Structure and mechanism of the human NHE1-CHP1 complex. Dong, Y., Gao, Y., Ilie, A. et al. Nat Commun (2021) 12:3474-3474. DOI 10.1038/s41467-021-23496-z · PubMed

Other PDB entries of the same protein (UniProt P19634 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
2YGG 2.23 Å, Complex of CaMBR and CaM
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide
2BEC 2.7 Å, Crystal structure of CHP2 in complex with its binding region in NHE1 and insights into…
23XI 2.93 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Zoniporide in…
23XK 3.1 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Cariporide in…
23XO 3.16 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Rimeporide in…
23XM 3.24 Å, Cryo-EM structure of human sodium/proton antiporter NHE1 in complex with Eniporide in an…
7DSV 3.4 Å, Structure of a human NHE1-CHP1 complex under pH 6.5
7DSX 3.5 Å, Structure of a human NHE1-CHP1 complex under pH 7.5, bound by cariporide

Browse structure collections

About this viewer

MolViewer shows 7DSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.