7DXC: TRPC3

Structure of TRPC3 at 3.06 angstrom in low calcium state. Determined by electron microscopy at 3.06 Å resolution. Released 2 Feb 2022.

Method: Electron microscopy
Resolution: 3.06 Å
Organism: Homo sapiens
Chains: 4
Atoms: 22,896
Mol. weight: 394.15 kDa
Ligands: POV, 98R, ZN, Y01
Released: 2 Feb 2022

Explore 7DXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DXC contains 156 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 39 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	26-36	11
α-helix	40-47	8
α-helix	65-71	7
α-helix	75-83	9
α-helix	90-99	10
α-helix	103-110	8
α-helix	113-116	4
α-helix	151-158	8
α-helix	161-169	9
α-helix	175-179	5
α-helix	185-192	8
α-helix	195-209	15
α-helix	212-218	7
α-helix	222-240	19
α-helix	244-263	20
α-helix	268-275	8
α-helix	295-302	8
α-helix	306-309	4
α-helix	312-322	11
α-helix	334-346	13
α-helix	348-353	6
α-helix	363-367	5
α-helix	370-391	22
α-helix	415-420	6
α-helix	422-423	2
α-helix	424-447	24
α-helix	449-454	6
α-helix	456-491	36
α-helix	505-509	5
α-helix	522-537	16
α-helix	538-543	6
α-helix	552-587	36
β-strand	594	1	1
α-helix	602-613	12
α-helix	620-622	3
β-strand	624	1	1
α-helix	629-661	33
α-helix	668-685	18
α-helix	693-695	3
α-helix	762-784	23
α-helix	787-801	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Short transient receptor potential channel 3	A, B, C, D	protein	836	Homo sapiens	Q13507 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7DXC_1 Short transient receptor potential channel 3 (chains A, B, C, D)
MREKGRRQAVRGPAFMFNDRGTSLTAEEERFLDAAEYGNIPVVRKMLEESKTLNVNCVDY
MGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILNHPGFAASKR
LTLSPCEQELQDDDFYAYDEDGTRFSPDITPIILAAHCQKYEVVHMLLMKGARIERPHDY
FCKCGDCMEKQRHDSFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLANIE
KEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESAEPLEVHRHKASLSRVKLA
IKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIAPC
SRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVTDYPKQIFRVKTT
QFTWTEMLIMVWVLGMMWSECKELWLEGPREYILQLWNVLDFGMLSIFIAAFTARFLAFL
QATKAQQYVDSYVQESDLSEVTLPPEIQYFTYARDKWLPSDPQIISEGLYAIAVVLSFSR
IAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFFAFMIGMFILYSYYLGAKVNAAFT
TVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMINS
SYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRIVNFPKCRRR
RLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKAQV
DKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSMLRCE

Ligands and cofactors

ID	Name	Formula	Copies
POV	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl…	C42 H82 N O8 P	4
98R	[(2S)-2-[(E)-octadec-10-enoyl]oxy-3-oxidanyl-propyl] octadec-10-enoate	C39 H72 O5	4
ZN	Zinc ion	Zn	4
Y01	Cholesterol hemisuccinate	C31 H50 O4	8

Primary citation

Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites. Guo, W., Tang, Q., Wei, M. et al. Neuron (2022) 110:1023-1035.e5. DOI 10.1016/j.neuron.2021.12.023 · PubMed

Other PDB entries of the same protein (UniProt Q13507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9U5C 2.25 Å, Structure of hTRPC3 in complex with Nb1-94 at 2.25 angstrom
9OLM 2.5 Å, Structure of human TRPC3 cerebellar splice variant (isoform c)
9KDB 2.67 Å, Structure of hTRPC3 in complex with Nb1-25 at 2.67 angstrom
7DXB 2.7 Å, Structure of TRPC3 at 2.7 angstrom in high calcium state
9KDD 2.7 Å, Structure of GSK1702934A-bound TRPC3 at 3.3 angstrom
9VFI 2.72 Å, Structure of hTRPC3 solubilized with 4F peptide at 2.72 angstrom
9OLK 2.8 Å, Structure of wild-type human TRPC3
9KDC 3.01 Å, Structure of hTRPC3 in complex with Nb3-37 at 3.01 angstrom
9OLL 3.1 Å, Structure of human TRPC3 T573A mutant
7DXE 3.2 Å, Structure of TRPC3 gain of function mutation R803C at 3.2 angstrom in 1340nM free…
6CUD 3.3 Å, Structure of the human TRPC3 in a lipid-occupied, closed state
9OLX 3.3 Å, Structure of a constitutively open human TRPC3 mutant in the inhibited state

Browse structure collections

About this viewer

MolViewer shows 7DXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.