7E72: Tie2-agonistic antibody

Crystal structure of Tie2-agonistic antibody in complex with human Tie2 Fn2-3. Determined by X-ray diffraction at 2.09 Å resolution. Released 10 Nov 2021.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 6
Atoms: 10,494
Mol. weight: 142.43 kDa
Released: 10 Nov 2021

Explore 7E72 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E72 contains 57 α-helices and 118 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	9-12	4	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	104-105	2	2
β-strand	109-113	5	2
α-helix	116-118	3
β-strand	119	1	3
α-helix	120-121	2
β-strand	122-126	5	4
α-helix	127-129	3
β-strand	137-147	11	4
β-strand	148	1	3
β-strand	153-156	4	5
α-helix	157-159	3
β-strand	161	1	5
β-strand	165-167	3	4
α-helix	168-170	3
β-strand	171-172	2	4
β-strand	178-187	10	4
α-helix	188-190	3
β-strand	197-202	6	5
α-helix	203-205	3
β-strand	207-212	6	5
α-helix	215-217	3

Chain B: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	44-49	6	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	85-90	6	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-106	5	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-154	2	10
α-helix	155	1
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-187	5
β-strand	191-197	7	10
β-strand	205-210	6	10

Chain C: 12 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	11
β-strand	9-12	4	12
β-strand	18-25	8	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	45-52	8	12
β-strand	57-60	4	12
α-helix	62-64	3
β-strand	68-73	6	11
α-helix	74-76	3
β-strand	78-83	6	11
α-helix	84	1
α-helix	88-90	3
β-strand	92-98	7	12
β-strand	104-105	2	12
β-strand	109-113	5	12
α-helix	116-118	3
β-strand	119	1	13
α-helix	120-121	2
β-strand	122-126	5	14
α-helix	127-129	3
β-strand	137-147	11	14
β-strand	148	1	13
β-strand	153-156	4	15
α-helix	157-159	3
β-strand	161	1	15
β-strand	165-167	3	14
α-helix	168-170	3
β-strand	171-172	2	14
β-strand	178-187	10	14
α-helix	188-190	3
β-strand	191	1	16
β-strand	194	1	16
β-strand	197-202	6	15
β-strand	207-212	6	15
α-helix	215-217	3

Chain D: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	17
β-strand	10-13	4	18
β-strand	19-25	7	17
β-strand	33-38	6	18
β-strand	44-49	6	18
β-strand	53-54	2	18
α-helix	55	1
β-strand	62-67	6	17
β-strand	70-75	6	17
α-helix	80-82	3
β-strand	85-90	6	18
α-helix	96	1
β-strand	97-98	2	18
β-strand	102-106	5	18
β-strand	111	1	19
α-helix	112-113	2
β-strand	114-118	5	20
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	20
β-strand	140	1	19
β-strand	145-150	6	21
β-strand	153-154	2	21
β-strand	159-163	5	20
α-helix	164-167	4
β-strand	173-182	10	20
α-helix	183-187	5
β-strand	191-197	7	21
β-strand	205-210	6	21

Chain E: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	544-546	3
β-strand	550-555	6	22
β-strand	558-562	5	22
α-helix	564-567	4
β-strand	575-582	8	23
β-strand	588-594	7	23
β-strand	599-602	4	22
β-strand	610-618	9	23
α-helix	623-628	6
β-strand	629-632	4	23
α-helix	633-635	3
α-helix	638-642	5
β-strand	643-648	6	24
β-strand	655-660	6	24
β-strand	669-676	8	25
β-strand	683-689	7	25
β-strand	696-699	4	24
α-helix	702-703	2
β-strand	707-715	9	25
β-strand	720	1	25
α-helix	725-726	2
β-strand	727-730	4	25
α-helix	731-734	4

Chain F: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	541-546	6
β-strand	550-555	6	26
β-strand	558-562	5	26
β-strand	575-582	8	27
β-strand	588-594	7	27
β-strand	599-602	4	26
β-strand	610-618	9	27
α-helix	622-628	7
β-strand	629-632	4	27
α-helix	633-635	3
α-helix	638-642	5
β-strand	643-648	6	28
β-strand	655-660	6	28
β-strand	669-676	8	25
β-strand	683-689	7	25
β-strand	696-699	4	28
α-helix	702-703	2
β-strand	707-715	9	25
β-strand	720	1	25
α-helix	721-723	3
α-helix	725-726	2
β-strand	727-730	4	25
α-helix	731-734	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
the chimeric Fab fragment of 3H7 (heavy chain)	A, C	protein	227	Homo sapiens
the chimeric Fab fragment of 3H7 (light chain)	B, D	protein	214	Homo sapiens
Angiopoietin-1 receptor	E, F	protein	199	Homo sapiens	Q02763 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7E72_1 the chimeric Fab fragment of 3H7 (heavy chain) (chains A, C)
QVQLQQPGAELVRPGASVKLSCKASGYSFTSYWMNWVKQRPGQGLEWIGMIHPSDSETRL
NQKFMDKATLTVDKSSSTAYMQLSSPTSEDSAVYYCARGLYGNSWGQGTLVTVSAASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHHHHHH

Sequence of entity 2 (B, D), FASTA

>7E72_2 the chimeric Fab fragment of 3H7 (light chain) (chains B, D)
DIQMTQSPSSLSASLGERVSLTCRASQDIGISLNWLQQEPDGTIKRLIYATSSLDSGVPK
RFSGSRSGSDYSLTISSLESEDFVDYYCLQYASSPYTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (E, F), FASTA

>7E72_3 Angiopoietin-1 receptor (chains E, F)
GSHMIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGN
LTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAV
ISWTILDGYSISSITIRYKVQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAEN
NIGSSNPAFSHELVTLPES

Primary citation

Structural insights into the clustering and activation of Tie2 receptor mediated by Tie2 agonistic antibody. Jo, G., Bae, J., Hong, H.J. et al. Nat Commun (2021) 12:6287-6287. DOI 10.1038/s41467-021-26620-1 · PubMed

Other PDB entries of the same protein (UniProt Q02763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BEA 2.02 Å, cFMS tyrosine kinase (tie2 KID) in complex with a pyrimidinopyridone inhibitor
6MWE 2.05 Å, Crystal structure of TIE2 in complex with decipera compound DP1919
1FVR 2.2 Å, TIE2 kinase domain
2OO8 2.2 Å, Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent,…
3L8P 2.4 Å, Crystal structure of cytoplasmic kinase domain of Tie2 complexed with inhibitor CEP11207
2P4I 2.5 Å, Evolution of a highly Selective and Potent 2-(Pyridin-2-yl)-1,3,5-triazine Tie-2 Kinase…
4X3J 2.5 Å, Selection of fragments for kinase inhibitor design: decoration is key
5UTK 2.5 Å, Crystal structure of the membrane proximal three fibronectin type III (FNIII) domains of…
5MYB 2.6 Å, Homodimerization of Tie2 Fibronectin-like domains 2 and 3 in space group P21
9LV4 2.67 Å, Cryo-EM Structure of Human Tie2/minibinder tw1102_4 helices Complex
2OSC 2.8 Å, Synthesis, Structural Analysis, and SAR Studies of Triazine Derivatives as Potent,…
2GY5 2.9 Å, Tie2 Ligand-Binding Domain Crystal Structure

Browse structure collections

About this viewer

MolViewer shows 7E72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.