7EL1: Protein from bacteria

Structure of a protein from bacteria. Determined by X-ray diffraction at 2.22 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 2.22 Å
Organism: Staphylococcus aureus
Chains: 5
Atoms: 11,628
Mol. weight: 170.48 kDa
Released: 28 Jul 2021

Explore 7EL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EL1 contains 63 α-helices and 50 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	5-11	7	1
β-strand	15-22	8	1
β-strand	28-35	8	1
α-helix	41-73	33
α-helix	88-95	8
α-helix	102-114	13
β-strand	118	1	2
α-helix	134-144	11
α-helix	150-161	12
α-helix	167-169	3
β-strand	172	1	2
α-helix	173-187	15
α-helix	195-206	12
α-helix	226-233	8
β-strand	236	1	3
β-strand	244	1	3
α-helix	245-246	2
β-strand	247	1	4
α-helix	251-263	13
β-strand	266-267	2	5
α-helix	277-283	7
α-helix	284-288	5
α-helix	296-303	8
α-helix	307-309	3
β-strand	310-311	2	5
β-strand	315	1	6
β-strand	321	1	6
α-helix	327-335	9
α-helix	339-342	4
α-helix	345-357	13
α-helix	361-369	9
α-helix	377-383	7
β-strand	392	1	4
α-helix	397-409	13
α-helix	414-420	7
α-helix	438-440	3
α-helix	441-444	4
α-helix	448-468	21
β-strand	473-478	6	1
α-helix	486-493	8
α-helix	499-511	13
α-helix	515-517	3
α-helix	518-529	12
β-strand	533	1	7
β-strand	540	1	7
α-helix	543-548	6
α-helix	550-552	3
β-strand	553-557	5	8
β-strand	572-576	5	8
α-helix	577-583	7
α-helix	588-592	5
α-helix	601-611	11
α-helix	617-619	3
α-helix	620-626	7
α-helix	635-644	10
α-helix	651-666	16
β-strand	672-675	4	1
α-helix	680-686	7
α-helix	699-722	24
α-helix	744-755	12
α-helix	758-764	7
β-strand	769-773	5	1
α-helix	774-775	2
β-strand	776	1	9
β-strand	789-790	2	10
β-strand	791-793	3	11
β-strand	799-805	7	11
α-helix	815-822	8
α-helix	824-826	3
β-strand	827	1	11
α-helix	828-831	4
α-helix	834-846	13
α-helix	853-861	9
β-strand	866	1	12
α-helix	874-875	2
β-strand	876	1	12
α-helix	877	1
β-strand	880-886	7	11
β-strand	891-892	2	10
α-helix	894-896	3
β-strand	904-906	3	10
β-strand	911-919	9	13
β-strand	922-929	8	13
α-helix	930-932	3
β-strand	933-935	3	14
β-strand	940-942	3	14
α-helix	944-953	10
α-helix	960	1
β-strand	961-966	6	13
β-strand	968	1	9
β-strand	971-974	4	15
β-strand	977-986	10	15
β-strand	991-995	5	15
α-helix	1001-1007	7
β-strand	1016-1019	4	15
β-strand	1027-1032	6	15
β-strand	1038-1040	3	15
β-strand	1050-1051	2	14

Chain E: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-12	9	16
β-strand	17-24	8	16
β-strand	28-37	10	16
α-helix	39-42	4
α-helix	47-52	6
α-helix	56-58	3
β-strand	59-62	4	16
α-helix	63-64	2
β-strand	69	1	17
α-helix	74	1
β-strand	75	1	17
α-helix	76	1
β-strand	77-78	2	16
α-helix	79-81	3
α-helix	83-96	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas9	A	protein	1053	Staphylococcus aureus	J7RUA5 (AlphaFold model)
RNA (73-mer)	B	RNA	73	Staphylococcus aureus
DNA (28-mer)	C	DNA	28	Staphylococcus aureus
DNA (5'-d(tptpgpapaptpapg)-3')	D	DNA	8	Staphylococcus aureus
100AA	E	protein	100	Staphylococcus aureus

Sequence of entity 1 (A), FASTA

>7EL1_1 CRISPR-associated endonuclease Cas9 (chains A)
MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRR
RHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHN
VNEVEEDTGNELSTKEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEA
KQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLMGHCTYF
PEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQIIENVFKQKKKPTLKQIA
KEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKDITARKEIIENAELLDQIAKILTIYQS
SEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNR
LKLVPKKVDLSQQKEIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAR
EKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEA
IPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEEASKKGNRTPFQYLSSSDSKIS
YETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNLVDTRYATRGLMNLL
RSYFRVNNLDVKVKSINGGFTSFLRRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKK
LDKAKKVMENQMFEEKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPN
RELINDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDPQTYQKL
KLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNS
RNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVIKKENYYEVNSKAYEEAKKLKKISNQA
EFIASFYNNDLIKINGELYRVIGVNNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTI
ASKTQSIKKYSTDILGNLYEVKSKKHPQIIKKG

Sequence of entity 2 (B), FASTA

>7EL1_2 RNA (73-MER) (chains B)
GGAAAUUAGGUGCGCUUGGCGUUUUAGUACUCUGGAAACAGAAUCUACUAAAACAAGGCA
AAAUGCCGUGUUU

Sequence of entity 3 (C), FASTA

>7EL1_3 DNA (28-MER) (chains C)
CTATTCAAGCCAAGCGCACCTAATTTCC

Sequence of entity 4 (D), FASTA

>7EL1_4 DNA (5'-D(*TP*TP*GP*AP*AP*TP*AP*G)-3') (chains D)
TTGAATAG

Sequence of entity 5 (E), FASTA

>7EL1_5 100AA (chains E)
MKSVKYISNMSKQEKGYRVYVNVVNEDTDKGFLFPSVPKEVIENDKIDELFNFEHHKPYV
QKAKSRYDKNGIGYKIVQLDEGFQKFIELNKEKMKENLDY

Primary citation

Structural basis of Staphylococcus aureus Cas9 inhibition by AcrIIA14. Liu, H., Zhu, Y., Lu, Z. et al. Nucleic Acids Res (2021) 49:6587-6595. DOI 10.1093/nar/gkab487 · PubMed

Other PDB entries of the same protein (UniProt J7RUA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ENH 2.1 Å, Crystal structure of cas and anti-cas protein complex
5CZZ 2.6 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
7ENI 2.63 Å, Crystal structure of cas and anti-cas protein complex
5AXW 2.7 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
8ZD0 2.76 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a translocation state
9MB7 2.88 Å, Cryo-EM structure of eSaCas9-NNG-guide RNA-mismatched target DNA complex
8ZCZ 2.9 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an intermediate state
8YWH 2.97 Å, Cryo-EM structure of small and dead form SaCas9-RNA-DNA ternary complex (sdCas9)
9MB6 3.01 Å, Cryo-EM structure of wild-type SaCas9-guide RNA-mismatched target DNA complex
8ZDA 3.14 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a catalytically active…
8ZCY 3.17 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an interrogation state
8JFT 3.31 Å, Cryo-EM structure of SaCas9-AcrIIA15 CTD-sgRNA complex

Browse structure collections

About this viewer

MolViewer shows 7EL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.