7ENH: Cas and anti-cas protein complex

Crystal structure of cas and anti-cas protein complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Staphylococcus aureus, Staphylococcus simulans
Chains: 2
Atoms: 2,179
Mol. weight: 32.25 kDa
Ligands: NI
Released: 20 Apr 2022

Explore 7ENH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ENH contains 20 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	503-512	10
α-helix	514-529	16
β-strand	533	1	1
β-strand	540	1	1
α-helix	543-548	6
α-helix	550-552	3
β-strand	553-557	5	2
α-helix	561-564	4
α-helix	569-571	3
β-strand	572-576	5	2
α-helix	577-583	7
α-helix	588-592	5
α-helix	601-609	9
α-helix	610-614	5
α-helix	620-626	7
α-helix	635-643	9

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	64-72	9	3
β-strand	76-84	9	3
β-strand	88-98	11	3
α-helix	99-103	5
α-helix	107-112	6
α-helix	116-118	3
β-strand	119-122	4	3
α-helix	123-124	2
β-strand	129	1	4
α-helix	134	1
β-strand	135	1	4
α-helix	136	1
β-strand	137-138	2	3
α-helix	139-141	3
α-helix	143-156	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRISPR-associated endonuclease Cas9	A	protein	166	Staphylococcus aureus	J7RUA5 (AlphaFold model)
AcrIIA14 protein	B	protein	100	Staphylococcus simulans

Sequence of entity 1 (A), FASTA

>7ENH_1 CRISPR-associated endonuclease Cas9 (chains A)
EKNSKDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKCLYSLEA
IPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKGNRTPFQYLSSSDSKIS
YETFKKHILNLAKGKGRISKTKKEYLLEERDINRFSVQKDFINRNL

Sequence of entity 2 (B), FASTA

>7ENH_2 AcrIIA14 protein (chains B)
MKSVKYISNMSKQEKGYRVYVNVVNEDTDKGFLFPSVPKEVIENDKIDELFNFEHHKPYV
QKAKSRYDKNGIGYKIVQLDEGFQKFIELNKEKMKENLDY

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	11

Primary citation

Crystal structure of cas and anti-cas protein complex. Wang, Y., Li, X. To be published.

Other PDB entries of the same protein (UniProt J7RUA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EL1 2.22 Å, Structure of a protein from bacteria
5CZZ 2.6 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
7ENI 2.63 Å, Crystal structure of cas and anti-cas protein complex
5AXW 2.7 Å, Crystal structure of Staphylococcus aureus Cas9 in complex with sgRNA and target DNA…
8ZD0 2.76 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a translocation state
9MB7 2.88 Å, Cryo-EM structure of eSaCas9-NNG-guide RNA-mismatched target DNA complex
8ZCZ 2.9 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an intermediate state
8YWH 2.97 Å, Cryo-EM structure of small and dead form SaCas9-RNA-DNA ternary complex (sdCas9)
9MB6 3.01 Å, Cryo-EM structure of wild-type SaCas9-guide RNA-mismatched target DNA complex
8ZDA 3.14 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in a catalytically active…
8ZCY 3.17 Å, Cryo-EM structure of eSaCas9_NNG-guide RNA-target DNA complex in an interrogation state
8JFT 3.31 Å, Cryo-EM structure of SaCas9-AcrIIA15 CTD-sgRNA complex

Browse structure collections

About this viewer

MolViewer shows 7ENH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.