7F0N: Deamidated Ubiquitin

Structure of deamidated Ubiquitin. Determined by X-ray diffraction at 1.6 Å resolution. Released 8 Jun 2022.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 792
Mol. weight: 8.87 kDa
Ligands: MG
Released: 8 Jun 2022

Explore 7F0N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F0N contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	12-16	5	1
β-strand	22	1	2
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	57-59	3
β-strand	66-71	6	1
α-helix	73-75	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-40S ribosomal protein S27a	A	protein	76	Homo sapiens	P62979 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F0N_1 Ubiquitin-40S ribosomal protein S27a (chains A)
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDEQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (K, NA) are not listed.

Primary citation

Structure of deamidated Ubiquitin. Rashmi, R., Mohanty, P., Aravind, R. et al. To be published.

Other PDB entries of the same protein (UniProt P62979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NHE 1.26 Å, High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin
6SQO 1.41 Å, Crystal structure of human MDM2 RING domain homodimer bound to UbcH5B-Ub
8GLP 1.67 Å, mRNA decoding in human is kinetically and structurally distinct from bacteria (Consensus…
3NS8 1.71 Å, Crystal structure of an open conformation of Lys48-linked diubiquitin at pH 7.5
3N32 1.79 Å, The crystal structure of human Ubiquitin adduct with Zeise's salt
6SQS 1.83 Å, Crystal structure of cat phospho-Ser429 MDM2 RING domain bound to UbcH5B-Ub
8QOI 1.9 Å, Structure of the human 80S ribosome at 1.9 A resolution - the molecular role of chemical…
9O3W 1.9 Å, Human 80S ribosome bound to IDB-001 stalled on MYC nascent chain
5WVO 2.0 Å, Crystal structure of DNMT1 RFTS domain in complex with K18/K23 mono-ubiquitylated…
3PHW 2.0 Å, OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with Ubiquitin
8YOO 2.0 Å, Cryo-EM structure of the human 80S ribosome with 100 um Tigecycline
9C3H 2.0 Å, Structure of the CNOT3-bound human 80S ribosome with tRNA-ARG in the P-site.

Browse structure collections

About this viewer

MolViewer shows 7F0N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.