7F1T: Human chemokine receptor CCR5

Crystal structure of the human chemokine receptor CCR5 in complex with MIP-1a. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Jul 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Clostridium pasteurianum
Chains: 1
Atoms: 3,372
Mol. weight: 55.51 kDa
Ligands: ZN
Released: 14 Jul 2021

Explore 7F1T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F1T contains 22 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	-87--86	2	1
α-helix	-78--76	3
α-helix	-75--73	3
β-strand	-72--67	6	2
α-helix	-66--65	2
β-strand	-57--53	5	2
β-strand	-48--45	4	2
α-helix	-40--28	13
α-helix	12-14	3
β-strand	20-21	2	1
α-helix	23-57	35
α-helix	64-80	17
α-helix	83-91	9
α-helix	97-130	34
α-helix	133-139	7
α-helix	142-165	24
β-strand	167-172	6	3
β-strand	175-180	6	3
α-helix	187-199	13
α-helix	200-204	5
α-helix	205-222	18
α-helix	1001-1003	3
β-strand	1004-1006	3	4
β-strand	1012-1013	2	4
β-strand	1038	1	5
β-strand	1045	1	5
α-helix	1046-1048	3
β-strand	1049-1050	2	4
α-helix	234-259	26
α-helix	269-288	20
α-helix	289-291	3
α-helix	293-299	7
α-helix	303-306	4
α-helix	309-311	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 3,C-C chemokine receptor type 5,Rubredoxin,C-C chemokine receptor type 5	A	protein	491	Homo sapiens, Clostridium pasteurianum	P00268 (AlphaFold model), P10147 (AlphaFold model), P51681 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F1T_1 C-C motif chemokine 3,C-C chemokine receptor type 5,Rubredoxin,C-C chemokine receptor type 5 (chains A)
SLAADTPTACCFSYCSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQK
YVSDLELSAGSGSGSGSGSGSGSGSGSGSGSGSDYQVSSPIYDINYYCSEPCQKINVKQI
AARLLPPLYSLVFIFGFVGNMLVILILINYKRLKSATDIYLLNLAISDLFFLLTVPFWAH
YAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVT
SVITWVVAVFASLPNIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLL
VMVICYSGILKTLLRMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVG
KDQFEEVEEEKKRHRDVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNALDQ
AMQVTEALGMTHCCINPIIYAFVGEEFRNYLLVFFQKHIAKRGRPLEVLFQGPHHHHHHH
HHHDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5. Zhang, H., Chen, K., Tan, Q. et al. Nat Commun (2021) 12:4151-4151. DOI 10.1038/s41467-021-24438-5 · PubMed

Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PVE 0.79 Å, NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of…
1IRO 1.1 Å, Rubredoxin (oxidized, fe(iii)) at 1.1 Å resolution
1IRN 1.2 Å, Rubredoxin (ZN-substituted) at 1.2 Å resolution
4RXN 1.2 Å, Crystallographic refinement of rubredoxin at 1.2 Å resolution
5RXN 1.2 Å, Combined crystallographic refinement and energy minimization of rubredoxin at 1.2 Å…
1SMM 1.36 Å, Crystal Structure of Cp Rd L41A mutant in oxidized state
1SMW 1.38 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
1SMU 1.43 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced)
1B13 1.5 Å, Clostridium pasteurianum rubredoxin G10A mutant
1FHH 1.5 Å, X-ray crystal structure of oxidized rubredoxin
1FHM 1.5 Å, X-ray crystal structure of reduced rubredoxin
1R0I 1.5 Å, cadmium-substituted rubredoxin

Browse structure collections

About this viewer

MolViewer shows 7F1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.