7F3S: Sth1 Bromodomain

Crystal structure of Sth1 Bromodomain in complex with H3K14bz peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae
Chains: 2
Atoms: 1,193
Mol. weight: 15.46 kDa
Released: 16 Mar 2022

Explore 7F3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F3S contains 10 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1252-1263	12
β-strand	1266	1	1
β-strand	1273	1	1
α-helix	1276-1278	3
α-helix	1281-1283	3
α-helix	1290-1293	4
α-helix	1300-1308	9
α-helix	1315-1332	18
β-strand	1333	1	2
α-helix	1334	1
α-helix	1338-1356	19

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	16	1	2
α-helix	18-22	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear protein STH1/NPS1	A	protein	112	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P32597 (AlphaFold model)
Thr-ala-arg-lys-ser-thr-gly-gly-lbz-ala-pro-arg-lys-gln-leu-ala-ser-tyr	B	protein	18	Saccharomyces cerevisiae	P61830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F3S_1 Nuclear protein STH1/NPS1 (chains A)
SLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNC
KNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS

Sequence of entity 2 (B), FASTA

>7F3S_2 THR-ALA-ARG-LYS-SER-THR-GLY-GLY-LBZ-ALA-PRO-ARG-LYS-GLN-LEU-ALA-SER-TYR (chains B)
TARKSTGGKAPRKQLASY

Primary citation

Global profiling of regulatory elements in the histone benzoylation pathway. Wang, D., Yan, F., Wu, P. et al. Nat Commun (2022) 13:1369-1369. DOI 10.1038/s41467-022-29057-2 · PubMed

Other PDB entries of the same protein (UniProt P32597 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KMJ 1.4 Å, Crystal structure of Sth1 bromodomain in complex with H3K14Ac
6UY1 2.21 Å, Crystal structure of the Sth1 bromodomain from Saccharomyces cerevisiae at 2.2 Angstrom…
6KMB 2.4 Å, Crystal structure of Sth1 bromodomain
6MR4 2.71 Å, Crystal structure of the Sth1 bromodomain from S.cerevisiae
6V8O 3.07 Å, RSC core
6K15 3.4 Å, RSC substrate-recruitment module
6VZ4 3.9 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102 bound to the nucleosome in ADP Beryllium…
6VZG 4.2 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102
6KW3 7.13 Å, The ClassA RSC-Nucleosome Complex
6KW4 7.55 Å, The ClassB RSC-Nucleosome Complex
6KW5 10.13 Å, The ClassC RSC-Nucleosome Complex
6TDA 15.0 Å, Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome

Browse structure collections

About this viewer

MolViewer shows 7F3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.