7F5F: SARS-CoV-2 ORF8 S84

SARS-CoV-2 ORF8 S84. Determined by X-ray diffraction at 1.62 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 1
Atoms: 903
Mol. weight: 12.01 kDa
Ligands: CA
Released: 19 Jan 2022

Explore 7F5F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F5F contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	1
β-strand	30-32	3	2
α-helix	37-38	2
β-strand	41-49	9	1
α-helix	56	1
β-strand	57-59	3	1
β-strand	61-64	4	3
β-strand	67-70	4	3
β-strand	80-83	4	2
β-strand	86-89	4	2
β-strand	96-104	9	1
β-strand	107-120	14	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF8 protein	A	protein	104	Severe acute respiratory syndrome coronavirus 2	P0DTC8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F5F_1 ORF8 protein (chains A)
QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIG
NYTVSCSPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal Structures of Bat and Human Coronavirus ORF8 Protein Ig-Like Domain Provide Insights Into the Diversity of Immune Responses. Chen, X., Zhou, Z., Huang, C. et al. Front Immunol (2021) 12:807134-807134. DOI 10.3389/fimmu.2021.807134 · PubMed

Other PDB entries of the same protein (UniProt P0DTC8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7JX6 1.61 Å, Structure of the SARS-CoV-2 ORF8 encoded accessory protein
7F8L 1.76 Å, Crystal structure of Bat coronavirus RaTG13 ORF8 accessory protein
7JTL 2.04 Å, Structure of SARS-CoV-2 ORF8 accessory protein
7XMN 2.3 Å, Structure of SARS-CoV-2 ORF8
7MX9 2.6 Å, Crystal structure of the SARS-CoV-2 ORF8 accessory protein

Browse structure collections

About this viewer

MolViewer shows 7F5F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.