7JX6: SARS-CoV-2 ORF8 encoded accessory protein

Structure of the SARS-CoV-2 ORF8 encoded accessory protein. Determined by X-ray diffraction at 1.61 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 1,822
Mol. weight: 24 kDa
Released: 23 Sept 2020

Explore 7JX6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JX6 contains 1 α-helix and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	19-25	7	1
β-strand	30-32	3	2
β-strand	42-49	8	1
β-strand	52	1	3
β-strand	57-59	3	1
β-strand	61-63	3	4
β-strand	68-70	3	4
β-strand	80-83	4	2
β-strand	86-89	4	2
β-strand	96-103	8	1
β-strand	112-120	9	1

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	20-25	6	3
β-strand	30-32	3	5
α-helix	33-35	3
β-strand	42-48	7	3
β-strand	50	1	6
β-strand	52	1	1
β-strand	57-59	3	3
β-strand	80-83	4	5
β-strand	86-89	4	5
β-strand	96	1	6
β-strand	98-103	6	3
β-strand	112-120	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF8 protein	A, B	protein	104	Severe acute respiratory syndrome coronavirus 2	P0DTC8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7JX6_1 ORF8 protein (chains A, B)
QECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIG
NYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Primary citation

Crystal Structure of the SARS-CoV-2 ORF8 Protein. Nelson, C.A., Hall, P.D., Fremont, D.H. To be published.

Other PDB entries of the same protein (UniProt P0DTC8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7F5F 1.62 Å, SARS-CoV-2 ORF8 S84
7F8L 1.76 Å, Crystal structure of Bat coronavirus RaTG13 ORF8 accessory protein
7JTL 2.04 Å, Structure of SARS-CoV-2 ORF8 accessory protein
7XMN 2.3 Å, Structure of SARS-CoV-2 ORF8
7MX9 2.6 Å, Crystal structure of the SARS-CoV-2 ORF8 accessory protein

Browse structure collections

About this viewer

MolViewer shows 7JX6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.