7F69: WIPI2b

Crystal structure of WIPI2b in complex with ATG16L1. Determined by X-ray diffraction at 1.5 Å resolution. Released 27 Jul 2022.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,836
Mol. weight: 42.8 kDa
Released: 27 Jul 2022

Explore 7F69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F69 contains 6 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	15-20	6	1
β-strand	26-31	6	1
β-strand	34-39	6	1
β-strand	48-52	5	1
β-strand	58-63	6	2
β-strand	69-74	6	2
β-strand	77-85	9	2
β-strand	90-96	7	2
β-strand	103-106	4	3
β-strand	110-114	5	3
β-strand	118-123	6	3
β-strand	129-134	6	3
α-helix	136	1
α-helix	138	1
β-strand	145-146	2	4
β-strand	154-158	5	4
β-strand	164-170	7	4
β-strand	175-176	2	4
α-helix	178-179	2
β-strand	180-183	4	4
α-helix	186	1
β-strand	187-192	6	5
β-strand	198-203	6	5
β-strand	208-213	6	5
β-strand	219-224	6	5
β-strand	235-238	4	6
β-strand	244-248	5	6
β-strand	253-258	6	6
β-strand	303-306	4	6
β-strand	315-321	7	7
β-strand	324-330	7	7
β-strand	335-340	6	7
β-strand	347-348	2	6
α-helix	349-350	2
β-strand	351-356	6	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	210-228	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of WD repeat domain phosphoinositide-interacting protein 2	A	protein	354	Homo sapiens	Q9Y4P8 (AlphaFold model)
Isoform 2 of Autophagy-related protein 16-1	C	protein	34	Homo sapiens	Q676U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F69_1 Isoform 2 of WD repeat domain phosphoinositide-interacting protein 2 (chains A)
GPGSGQLLFANFNQDNTSLAVGSKSGYKFFSLSSVDKLEQIYECTDTEDVCIVERLFSSS
LVAIVSLKAPRKLKVCHFKKGTEICNYSYSNTILAVKLNRQRLIVCLEESLYIHNIRDMK
VLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLA
ALAFDASGTKLATASEKGTVIRVFSIPEGQKLFEFRRGVKRCVSICSLAFSMDGMFLSAS
SNTETVHIFKLETVKEKPPEEPTTWTGYFGKVLMASTSYLPSQVTEMFNQGRAFATVRLP
FCGHKNICSLATIQKIPRLLVGAADGYLYMYNLDPQEGGECALMKQHRLDGSLV

Sequence of entity 2 (C), FASTA

>7F69_2 Isoform 2 of Autophagy-related protein 16-1 (chains C)
GPGSAENEKDSRRRQARLQKELAEAAKEPLPVEQ

Primary citation

ATG16L1 adopts a dual-binding site mode to interact with WIPI2b in autophagy. Gong, X., Wang, Y., Tang, Y. et al. Sci Adv (2023) 9:eadf0824-eadf0824. DOI 10.1126/sciadv.adf0824 · PubMed

Other PDB entries of the same protein (UniProt Q9Y4P8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XFR 1.76 Å, Crystal structure of WIPI2b in complex with the second site of ATG16L1
7MU2 1.85 Å, Crystal Structure of WIPI2 in complex with W2IR of ATG16L1

Browse structure collections

About this viewer

MolViewer shows 7F69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.