7F9A: Homo sapiens Prolyl-tRNA Synthetase

Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with L-proline and compound L97. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Oct 2022.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 8,125
Mol. weight: 116.88 kDa
Ligands: PRO, CA, ZN, 1XK
Released: 5 Oct 2022

Explore 7F9A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F9A contains 50 α-helices and 66 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	1024-1034	11
β-strand	1038-1040	3	1
β-strand	1047-1049	3	1
α-helix	1051-1070	20
β-strand	1074-1075	2	2
β-strand	1077	1	3
β-strand	1081-1083	3	4
α-helix	1084-1087	4
α-helix	1091-1097	7
α-helix	1098-1100	3
β-strand	1102-1107	6	4
β-strand	1110-1118	9	4
α-helix	1119	1
α-helix	1123-1133	11
β-strand	1136	1	5
α-helix	1137-1139	3
β-strand	1142-1151	10	2
α-helix	1157-1158	2
β-strand	1159	1	6
β-strand	1163	1	6
β-strand	1166-1176	11	2
α-helix	1179-1195	17
α-helix	1196-1200	5
β-strand	1206-1209	4	2
α-helix	1210-1211	2
α-helix	1212-1214	3
α-helix	1216	1
β-strand	1221-1229	9	2
β-strand	1234-1245	12	2
α-helix	1249-1252	4
β-strand	1255-1256	2	7
β-strand	1257	1	5
β-strand	1266-1267	2	7
α-helix	1268	1
β-strand	1269-1276	8	2
α-helix	1278-1287	10
β-strand	1289	1	8
β-strand	1292	1	8
β-strand	1304-1308	5	9
α-helix	1317-1336	20
β-strand	1341-1343	3	9
α-helix	1351-1360	10
β-strand	1365-1369	5	9
α-helix	1371-1375	5
β-strand	1378-1383	6	9
β-strand	1389-1393	5	9
α-helix	1394-1396	3
α-helix	1397-1423	27
β-strand	1424-1426	3	10
α-helix	1430-1438	9
β-strand	1442-1447	6	10
α-helix	1451-1463	13
β-strand	1477-1480	4	10
β-strand	1481-1482	2	2
α-helix	1488-1490	3
α-helix	1493	1
β-strand	1494	1	11
α-helix	1495	1
β-strand	1501	1	11
β-strand	1504-1509	6	10
β-strand	1511	1	2

Chain B: 23 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	1024-1034	11
β-strand	1038-1040	3	3
β-strand	1047-1049	3	3
α-helix	1051-1070	20
β-strand	1074-1075	2	12
β-strand	1077	1	1
β-strand	1081-1082	2	4
α-helix	1084-1087	4
α-helix	1091-1097	7
α-helix	1098-1100	3
β-strand	1102-1107	6	4
β-strand	1110-1118	9	4
α-helix	1119	1
α-helix	1123-1133	11
α-helix	1137-1139	3
β-strand	1142-1151	10	12
α-helix	1157-1158	2
β-strand	1159	1	13
β-strand	1163	1	13
β-strand	1166-1176	11	12
α-helix	1179-1195	17
α-helix	1196-1200	5
β-strand	1206-1209	4	12
α-helix	1216	1
β-strand	1221-1229	9	12
β-strand	1234-1245	12	12
α-helix	1249-1252	4
β-strand	1255-1257	3	14
β-strand	1265-1267	3	14
α-helix	1268	1
β-strand	1269-1276	8	12
α-helix	1278-1287	10
β-strand	1289	1	15
β-strand	1292	1	15
β-strand	1304-1308	5	16
α-helix	1317-1336	20
β-strand	1341-1343	3	16
α-helix	1351-1360	10
β-strand	1365-1369	5	16
α-helix	1371-1374	4
β-strand	1378-1383	6	16
β-strand	1389-1393	5	16
α-helix	1394-1396	3
α-helix	1397-1423	27
β-strand	1424-1426	3	17
α-helix	1430-1438	9
β-strand	1442-1447	6	17
α-helix	1451-1461	11
β-strand	1477-1480	4	17
β-strand	1481-1482	2	12
α-helix	1488-1490	3
β-strand	1494	1	18
β-strand	1501	1	18
β-strand	1504-1509	6	17
β-strand	1511	1	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bifunctional glutamate/proline--tRNA ligase	A, B	protein	505	Homo sapiens	P07814 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7F9A_1 Bifunctional glutamate/proline--tRNA ligase (chains A, B)
PKKQTRLGLEAKKEENLADWYSQVITKSEMIEYHDISGCYILRPWAYAIWEAIKDFFDAE
IKKLGVENCYFPMFVSQSALEKEKTHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMY
PAYAKWVQSHRDLPIKLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATMEEAAEEVL
QILDLYAQVYEELLAIPVVKGRKTEKEKFAGGDYTTTIEAFISASGRAIQGGTSHHLGQN
FSKMFEIVFEDPKIPGEKQFAYQNSWGLTTRTIGVMTMVHGDNMGLVLPPRVACVQVVII
PCGITNALSEEDKEALIAKCNDYRRRLLSVNIRVRADLRDNYSPGWKFNHWELKGVPIRL
EVGPRDMKSCQFVAVRRDTGEKLTVAENEAETKLQAILEDIQVTLFTRASEDLKTHMVVA
NTMEDFQKILDSGKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLC
ELQPGAKCVCGKNPAKYYTLFGRSY

Ligands and cofactors

ID	Name	Formula	Copies
PRO	Proline	C5 H9 N O2	2
CA	Calcium ion	Ca	10
ZN	Zinc ion	Zn	2
1XK	4-[(3S)-3-cyclopropyl-3-(hydroxymethyl)-2-oxidanylidene-pyrrolidin-1-yl]-N-[[3-…	C26 H28 F N5 O3	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Targeting prolyl-tRNA synthetase via a series of ATP-mimetics to accelerate drug discovery against toxoplasmosis. Yogavel, M., Bougdour, A., Mishra, S. et al. PLoS Pathog (2023) 19:e1011124-e1011124. DOI 10.1371/journal.ppat.1011124 · PubMed

Other PDB entries of the same protein (UniProt P07814 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X09 1.7 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with inhibitors L95 and…
7F99 1.98 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with L-proline and compound L96
7Y1H 1.99 Å, Controlling fibrosis using compound with novel binding mode to prolyl-tRNA synthetase 1
7F9B 2.0 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with L-proline and compound L95
7F98 2.0 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with L-proline and compound L95
4HVC 2.0 Å, Crystal structure of human prolyl-tRNA synthetase in complex with halofuginone and ATP…
7X1O 2.04 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with double inhibitors HF and L95
5A1N 2.1 Å, The crystal structure of the GST-like domains complex of EPRS-AIMP2 mutant S156D
7BBU 2.19 Å, Crystal Structure of human Prolyl-tRNA synthetase in complex with NCP26 and L-Proline
7F9C 2.2 Å, Homo sapiens Prolyl-tRNA Synthetase (HsPRS) in Complex with L-proline and compound L96
7OSY 2.23 Å, Human Prolyl-tRNA Synthetase in Complex with L-proline
7Y28 2.29 Å, Controlling fibrosis using compound with novel binding mode to prolyl-tRNA synthetase 1

Browse structure collections

About this viewer

MolViewer shows 7F9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.