Crystal structure of human immunoglobulin fragment FAB new refined at 2.0 Å resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Jan 1994.
Explore 7FAB in 3D Show helices and sheets RCSB PDB PDBe
7FAB contains 16 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 33-39 | 7 | 9 |
| β-strand | 46-51 | 6 | 9 |
| β-strand | 57-59 | 3 | 9 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-98 | 8 | 9 |
| β-strand | 104-107 | 4 | 9 |
| β-strand | 111-113 | 3 | 9 |
| β-strand | 114-115 | 2 | 8 |
| α-helix | 119-120 | 2 | |
| β-strand | 121 | 1 | 10 |
| α-helix | 122-123 | 2 | |
| β-strand | 124-128 | 5 | 11 |
| β-strand | 140-149 | 10 | 11 |
| β-strand | 150 | 1 | 10 |
| β-strand | 155-158 | 4 | 12 |
| α-helix | 159-161 | 3 | |
| β-strand | 163 | 1 | 12 |
| β-strand | 167-169 | 3 | 11 |
| α-helix | 170-172 | 3 | |
| β-strand | 173-174 | 2 | 11 |
| β-strand | 180-188 | 9 | 11 |
| α-helix | 190-192 | 3 | |
| β-strand | 199-204 | 6 | 12 |
| α-helix | 205-207 | 3 | |
| β-strand | 209-214 | 6 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 1 |
| β-strand | 5 | 1 | 2 |
| β-strand | 9-12 | 4 | 3 |
| β-strand | 18-23 | 6 | 2 |
| α-helix | 29-31 | 3 | |
| β-strand | 36-40 | 5 | 3 |
| β-strand | 47-48 | 2 | 3 |
| β-strand | 57-62 | 6 | 2 |
| β-strand | 65-70 | 6 | 2 |
| α-helix | 75-77 | 3 | |
| β-strand | 79-87 | 9 | 3 |
| β-strand | 90-93 | 4 | 3 |
| β-strand | 94 | 1 | 1 |
| β-strand | 97-101 | 5 | 3 |
| α-helix | 104-106 | 3 | |
| β-strand | 107 | 1 | 4 |
| α-helix | 108-109 | 2 | |
| β-strand | 110-114 | 5 | 5 |
| α-helix | 115-117 | 3 | |
| α-helix | 118-122 | 5 | |
| β-strand | 126-135 | 10 | 5 |
| β-strand | 136 | 1 | 4 |
| β-strand | 141-146 | 6 | 6 |
| β-strand | 149-151 | 3 | 6 |
| β-strand | 155-157 | 3 | 5 |
| α-helix | 158-160 | 3 | |
| β-strand | 161-162 | 2 | 5 |
| β-strand | 168-176 | 9 | 5 |
| α-helix | 178-182 | 5 | |
| β-strand | 187-193 | 7 | 6 |
| β-strand | 196-202 | 7 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| IgG1-lambda new FAB (light chain) | L | protein | 208 | Homo sapiens | P0DOY2 (AlphaFold model) |
| IgG1-lambda new FAB (heavy chain) | H | protein | 217 | Homo sapiens | P01825 (AlphaFold model) |
>7FAB_1 IGG1-LAMBDA NEW FAB (LIGHT CHAIN) (chains L) ASVLTQPPSVSGAPGQRVTISCTGSSSNIGAGHNVKWYQQLPGTAPKLLIFHNNARFSVS KSGTSATLAITGLQAEDEADYYCQSYDRSLRVFGGGTKLTVLRQPKAAPSVTLFPPSSEE LQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQ WKSHKSYSCQVTHEGSTVEKTVAPTECS
>7FAB_2 IGG1-LAMBDA NEW FAB (HEAVY CHAIN) (chains H) AVQLEQSGPGLVRPSQTLSLTCTVSGTSFDDYYWTWVRQPPGRGLEWIGYVFYTGTTLLD PSLRGRVTMLVNTSKNQFSLRLSSVTAADTAVYYCARNLIAGGIDVWGQGSLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Crystal structure of human immunoglobulin fragment Fab New refined at 2.0 A resolution. Saul, F.A., Poljak, R.J. Proteins (1992) 14:363-371. DOI 10.1002/prot.340140305 · PubMed
Other PDB entries of the same protein (UniProt P0DOY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7FAB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.