luteinizing hormone/choriogonadotropin receptor. Determined by electron microscopy at 3.8 Å resolution. Released 29 Sept 2021.
Explore 7FIJ in 3D Show helices and sheets RCSB PDB PDBe
7FIJ contains 15 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 40-41 | 2 | 1 |
| β-strand | 43 | 1 | 2 |
| β-strand | 44-45 | 2 | 1 |
| β-strand | 56 | 1 | 3 |
| β-strand | 61 | 1 | 2 |
| β-strand | 77 | 1 | 3 |
| β-strand | 80 | 1 | 3 |
| β-strand | 94 | 1 | 4 |
| β-strand | 102-105 | 4 | 3 |
| β-strand | 119 | 1 | 4 |
| β-strand | 127-131 | 5 | 3 |
| β-strand | 146 | 1 | 5 |
| β-strand | 152-156 | 5 | 3 |
| β-strand | 163-164 | 2 | 6 |
| α-helix | 165 | 1 | |
| β-strand | 173 | 1 | 5 |
| β-strand | 177-180 | 4 | 3 |
| β-strand | 188-189 | 2 | 6 |
| β-strand | 198 | 1 | 7 |
| β-strand | 199-203 | 5 | 3 |
| β-strand | 212 | 1 | 6 |
| β-strand | 222 | 1 | 7 |
| β-strand | 226-228 | 3 | 3 |
| α-helix | 242-244 | 3 | |
| β-strand | 247-250 | 4 | 3 |
| β-strand | 270-273 | 4 | 3 |
| α-helix | 279-282 | 4 | |
| α-helix | 363-386 | 24 | |
| α-helix | 393-419 | 27 | |
| α-helix | 430-434 | 5 | |
| α-helix | 438-467 | 30 | |
| α-helix | 471-476 | 6 | |
| α-helix | 480-503 | 24 | |
| α-helix | 522-551 | 30 | |
| α-helix | 561-594 | 34 | |
| α-helix | 604-606 | 3 | |
| α-helix | 607-611 | 5 | |
| α-helix | 614-623 | 10 | |
| α-helix | 628-640 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lutropin-choriogonadotropic hormone receptor | R | protein | 697 | Homo sapiens | P22888 (AlphaFold model) |
>7FIJ_1 Lutropin-choriogonadotropic hormone receptor (chains R) DYKDDDDVENLYFQGASALCPEPCNCVPDGALRCPGPTAGLTRLSLAYLPVKVIPSQAFR GLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSI CNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQ SHAFNGTTLTSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIA TSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENFSKQCESTVRK VNNKTLYSSMLAESELSGWDYEYGFCLPKTPRCAPEPDAFNPCEDIMGYDFLRVLIWLIN ILAIMGNMTVLFVLLTSRYKLTVPRFLMCNLSFADFCMGLYLLLIASVDSQTKGQYYNHA IDWQTGSGCSTAGFFTVFASELSVYTLTVITLERWHTITYAIHLDQKLRLRHAILIMLGG WLFSSLIAMLPLVGVSNYMKVSICFPMDVETTLSQVYILTILILNVVAFFIICACYIKIY FAVRNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKVPLITVTNSKVLLVL FYPINSCANPFLYAIFTKTFQRDFFLLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGS NKPSQSTLKLSTLHCQGTALLDKTRYTECHHHHHHHH
Structures of full-length glycoprotein hormone receptor signalling complexes. Duan, J., Xu, P., Cheng, X. et al. Nature (2021) 598:688-692. DOI 10.1038/s41586-021-03924-2 · PubMed
Other PDB entries of the same protein (UniProt P22888 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7FIJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.