PanDDA analysis group deposition -- Crystal structure of HSP90N in complex with PS-3621. Determined by X-ray diffraction at 1.38 Å resolution. Released 26 Mar 2025.
Explore 7HBT in 3D Show helices and sheets RCSB PDB PDBe
7HBT contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-21 | 4 | 1 |
| α-helix | 22-23 | 2 | |
| α-helix | 24-35 | 12 | |
| α-helix | 43-65 | 23 | |
| α-helix | 67-70 | 4 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 100-104 | 5 | |
| α-helix | 106-108 | 3 | |
| α-helix | 111-123 | 13 | |
| α-helix | 128-134 | 7 | |
| α-helix | 137-143 | 7 | |
| β-strand | 145-153 | 9 | 1 |
| β-strand | 160-164 | 5 | 1 |
| β-strand | 169-174 | 6 | 1 |
| β-strand | 183-190 | 8 | 1 |
| α-helix | 192-198 | 7 | |
| α-helix | 200-210 | 11 | |
| β-strand | 218-220 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein HSP 90-alpha | A | protein | 237 | Homo sapiens | P07900 (AlphaFold model) |
>7HBT_1 Heat shock protein HSP 90-alpha (chains A) MDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDP SKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGAD ISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVI LHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAELEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1AXR | [3-(4-methylphenyl)-1H-pyrazol-1-yl]acetic acid | C12 H12 N2 O2 | 1 |
Novel starting points for fragment-based drug design against human heat-shock protein 90 identified using crystallographic fragment screening. Huang, L., Wang, W., Zhu, Z. et al. IUCrJ (2025) 12:177-187. DOI 10.1107/S2052252524012247 · PubMed
Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7HBT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.