7HNU: E3 ubiquitin-protein ligase TRIM21

Name: PDB 7HNU: PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1614545742
Published: 2024-11-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z1614545742. Determined by X-ray diffraction at 1.15 Å resolution. Released 27 Nov 2024.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,736
Mol. weight: 21.99 kDa
Ligands: GQJ
Released: 27 Nov 2024

Explore 7HNU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7HNU contains 5 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	11-13	3
β-strand	14	1	1
β-strand	19	1	2
β-strand	28-30	3	1
β-strand	36-39	4	1
α-helix	46-48	3
β-strand	58-60	3	3
β-strand	61	1	2
β-strand	65	1	3
β-strand	69-75	7	1
β-strand	82-88	7	3
α-helix	101-103	3
β-strand	105-111	7	3
β-strand	114-117	4	3
β-strand	123-124	2	3
β-strand	133-139	7	1
β-strand	144-149	6	1
β-strand	155-160	6	1
β-strand	169-174	6	3
α-helix	185-186	2
β-strand	187-189	3	1
α-helix	190-191	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM21	B	protein	188	Mus musculus	Q62191 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7HNU_1 E3 ubiquitin-protein ligase TRIM21 (chains B)
MHHHHHHMVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFS
SGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLH
IQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAP
LKLCPLKM

Ligands and cofactors

ID	Name	Formula	Copies
GQJ	methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxidanyl-pyrrolidine-2-carboxylate	C11 H13 N O5	1

Water and common crystallization additives (SO4, EDO) are not listed.

Primary citation

PanDDA analysis group deposition. Kim, Y., Marples, P., Fearon, D. et al. To be published.

Other PDB entries of the same protein (UniProt Q62191 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7HLL 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with…
7HLM 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z29077827
7HLO 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z90122368
7HLS 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z29177127
7HLT 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z328695024
7HLU 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z741055844
7HM2 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z32400357
7HMA 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z291279160
7HMP 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with…
7HMR 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with…
7HMS 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with Z126932614
7HMU 1.15 Å, PanDDA analysis group deposition -- Crystal Structure of TRIM21 in complex with…

Browse structure collections

About this viewer

MolViewer shows 7HNU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.