Crystal Structure of 18 bound to CK2a. Determined by X-ray diffraction at 1.31 Å resolution. Released 14 Jan 2026.
Explore 7I8O in 3D Show helices and sheets RCSB PDB PDBe
7I8O contains 29 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 15-18 | 4 | |
| α-helix | 21-24 | 4 | |
| α-helix | 26-28 | 3 | |
| α-helix | 29-31 | 3 | |
| α-helix | 36-38 | 3 | |
| β-strand | 39-47 | 9 | 1 |
| β-strand | 51-58 | 8 | 1 |
| β-strand | 63-70 | 8 | 1 |
| α-helix | 71 | 1 | |
| α-helix | 75-88 | 14 | |
| β-strand | 94 | 1 | 2 |
| α-helix | 95-96 | 2 | |
| β-strand | 97-102 | 6 | 1 |
| β-strand | 109-114 | 6 | 1 |
| α-helix | 118-120 | 3 | |
| α-helix | 121-127 | 7 | |
| α-helix | 130-149 | 20 | |
| β-strand | 152-153 | 2 | 3 |
| α-helix | 159-161 | 3 | |
| β-strand | 162-165 | 4 | 2 |
| α-helix | 166-168 | 3 | |
| β-strand | 170-173 | 4 | 2 |
| α-helix | 176-178 | 3 | |
| β-strand | 180-181 | 2 | 3 |
| α-helix | 195-197 | 3 | |
| α-helix | 200-203 | 4 | |
| α-helix | 212-226 | 15 | |
| α-helix | 238-249 | 12 | |
| α-helix | 251-260 | 10 | |
| α-helix | 267-271 | 5 | |
| α-helix | 277-280 | 4 | |
| α-helix | 281-284 | 4 | |
| α-helix | 290-292 | 3 | |
| α-helix | 295-304 | 10 | |
| α-helix | 309-311 | 3 | |
| α-helix | 313-314 | 2 | |
| α-helix | 315-319 | 5 | |
| α-helix | 322-324 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Casein kinase II subunit alpha | A | protein | 328 | Homo sapiens | P68400 (AlphaFold model) |
>7I8O_1 Casein kinase II subunit alpha (chains A) SGPVPSRARVYTDVNTHRPSEYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITN NEKVVVKILKPVAAAKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDF KQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEF YHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQ LVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFL DKLLRYDHQSRLTAREAMEHPYFYTVVK
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1BZW | 5-({2-[(4-{[(2-chloro[1,1'-biphenyl]-4-yl)methyl]amino}butyl)amino]ethyl}amino)… | C32 H32 Cl N5 O2 | 1 |
Water and common crystallization additives (ACT) are not listed.
Exploiting the Cryptic alpha D Pocket of Casein Kinase 2 alpha (CK2 alpha ) to Deliver Highly Potent and Selective Type 1 Inhibitors. Glossop, P.A., Brear, P., Wright, S. et al. J Med Chem (2025) 68:21587-21614. DOI 10.1021/acs.jmedchem.5c01807 · PubMed
Other PDB entries of the same protein (UniProt P68400 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7I8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.