7JIC: Human CD19-CD81 co-receptor complex

Structure of human CD19-CD81 co-receptor complex bound to coltuximab Fab fragment. Determined by electron microscopy at 3.8 Å resolution. Released 20 Jan 2021.

Method: Electron microscopy
Resolution: 3.8 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 5,980
Mol. weight: 110.52 kDa
Released: 20 Jan 2021

Explore 7JIC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JIC contains 17 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	32-36	5	2
β-strand	49-53	5	3
β-strand	60-65	6	3
β-strand	71-75	5	2
β-strand	80-84	5	2
β-strand	93-98	6	4
β-strand	108-115	8	4
β-strand	120-123	4	5
β-strand	155-158	4	5
β-strand	159-160	2	6
β-strand	163-164	2	6
β-strand	188-190	3	4
β-strand	196-197	2	2
β-strand	211-217	7	4
β-strand	223	1	4
β-strand	227-229	3	4
α-helix	235-236	2
β-strand	239-242	4	2
β-strand	246-251	6	2
β-strand	257-259	3	1
β-strand	260-261	2	3
β-strand	270-273	4	1
α-helix	293-312	20

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	10-36	27
α-helix	39-44	6
α-helix	59-81	23
α-helix	90-114	25
α-helix	118-134	17
α-helix	143-153	11
α-helix	161-164	4
α-helix	182-223	42

Chain H: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	7
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	33-39	7	9
β-strand	45-52	8	9
β-strand	56-59	4	9
α-helix	61-63	3
β-strand	67-72	6	7
β-strand	77-82	6	7
β-strand	92-98	7	9
β-strand	106-109	4	9
β-strand	115-117	3	8
α-helix	123-125	3
β-strand	126-130	5	10
α-helix	131-133	3
β-strand	141-151	11	10
β-strand	157-160	4	11
β-strand	169-176	8	10
α-helix	177	1
β-strand	182-191	10	10
β-strand	200-205	6	11
β-strand	213-217	5	11

Chain L: 3 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	12
β-strand	10-13	4	13
β-strand	19-24	6	12
β-strand	33-37	5	13
β-strand	44-47	4	13
β-strand	53	1	13
β-strand	61-66	6	12
β-strand	69-74	6	12
β-strand	84-88	5	13
β-strand	96	1	9
β-strand	101-105	5	13
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-135	8	14
β-strand	144-149	6	15
β-strand	153	1	15
β-strand	158-162	5	14
β-strand	174-181	8	14
α-helix	182-185	4
β-strand	190-196	7	15
β-strand	204-209	6	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-lymphocyte antigen CD19	A	protein	323	Homo sapiens	P15391 (AlphaFold model)
CD81 antigen	B	protein	247	Homo sapiens	P60033 (AlphaFold model)
Coltuximab Heavy Chain	H	protein	233	Mus musculus
Coltuximab Light Chain	L	protein	213	Mus musculus

Sequence of entity 1 (A), FASTA

>7JIC_1 B-lymphocyte antigen CD19 (chains A)
DYKDDDDLEVLFQGPPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKL
SLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRW
NVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSL
SQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMET
GLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCL
CSLVGILHLQRALVLRRKRKRMT

Sequence of entity 2 (B), FASTA

>7JIC_2 CD81 antigen (chains B)
GGSGGSGGSGGSGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLEL
GDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAG
IWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSV
LTSNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCG
IRNSSVY

Sequence of entity 3 (H), FASTA

>7JIC_3 Coltuximab Heavy Chain (chains H)
QVQLVQPGAEVVKPGASVKLSCKTSGYTFTSNWMHWVKQAPGQGLEWIGEIDPSDSYTNY
NQNFQGKAKLTVDKSTSTAYMEVSSLRSDDTAVYYCARGSNPYYYAMDYWGQGTSVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGGSGLEVLFQ

Sequence of entity 4 (L), FASTA

>7JIC_4 Coltuximab Light Chain (chains L)
EIVLTQSPAIMSASPGERVTMTCSASSGVNYMHWYQQKPGTSPRRWIYDTSKLASGVPAR
FSGSGSGTDYSLTISSMEPEDAATYYCHQRGSXXYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

Cryo-EM structure of the B cell co-receptor CD19 bound to the tetraspanin CD81. Susa, K.J., Rawson, S., Kruse, A.C. et al. Science (2021) 371:300-304. DOI 10.1126/science.abd9836

Other PDB entries of the same protein (UniProt P15391 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AL5 3.0 Å, Complex between CD19 (N138Q mutant) and B43 FAB
7URV 3.05 Å, FMC63 scFv in complex with soluble CD19
7URX 3.4 Å, SJ25C1 Fab in complex with soluble CD19

Browse structure collections

About this viewer

MolViewer shows 7JIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.