7JJM: Importin alpha 2

Crystal structure of Importin alpha 2 in complex with LSD1 NLS. Determined by X-ray diffraction at 2.06 Å resolution. Released 5 Aug 2020.

Method: X-ray diffraction
Resolution: 2.06 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 3,396
Mol. weight: 54.15 kDa
Released: 5 Aug 2020

Explore 7JJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JJM contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	78-86	9
α-helix	90-106	17
α-helix	112-117	6
α-helix	120-128	9
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-211	6
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-477	9
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lysine-specific histone demethylase 1A	A	protein	26	Homo sapiens	O60341 (AlphaFold model)
Importin subunit alpha-1	B	protein	470	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7JJM_1 Lysine-specific histone demethylase 1A (chains A)
TPEGRRTSRRKRAKVEYREMDESLAN

Sequence of entity 2 (B), FASTA

>7JJM_2 Importin subunit alpha-1 (chains B)
SPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLI
PKFVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQ
AVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKN
PAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKL
LGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSN
ITAGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGI
IEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHEN
ESVYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNFGS

Primary citation

Targeting Nuclear LSD1 to Reprogram Cancer Cells and Reinvigorate Exhausted T Cells via a Novel LSD1-EOMES Switch. Tu, W.J., McCuaig, R.D., Tan, A.H.Y. et al. Front Immunol (2020) 11:1228. DOI 10.3389/fimmu.2020.01228

Other PDB entries of the same protein (UniProt O60341 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E1F 1.16 Å, Crystal structure of the SWIRM domain of human histone lysine-specific demethylase LSD1
5IT3 1.4 Å, Swirm domain of human Lsd1
5AFW 1.6 Å, Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation
7JK7 1.96 Å, Crystal structure of Importin alpha 2 in complex with LSD1 NLS S111E mutant
2Z3Y 2.25 Å, Crystal structure of Lysine-specific demethylase1
2Z5U 2.25 Å, Crystal structure of Lysine-specific histone demethylase 1
6KGO 2.25 Å, LSD1-S2157 five-membered ring adduct model
6KGP 2.25 Å, LSD1-S2157 N5 adduct model
7E0G 2.25 Å, Crystal structure of Lysine Specific Demethylase 1 (LSD1) with TAK-418, FAD-adduct
7XW8 2.28 Å, Crystal structure of Lysine Specific Demethylase 1 (LSD1) with TAK-418 distomer,…
2DW4 2.3 Å, Crystal structure of human LSD1 at 2.3 A resolution
6KGQ 2.32 Å, LSD1-FCPA-MPE five-membered ring adduct model

Browse structure collections

About this viewer

MolViewer shows 7JJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.