5AFW: Chromodomain-helicase-DNA-binding protein 1

Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Jan 2016.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,579
Mol. weight: 22.73 kDa
Released: 13 Jan 2016

Explore 5AFW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AFW contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	273	1	1
β-strand	274-284	11	2
α-helix	290-292	3
α-helix	294-300	7
β-strand	314-322	9	2
α-helix	327-329	3
β-strand	331-333	3	2
α-helix	335-340	6
β-strand	344	1	1
α-helix	347-360	14
α-helix	375-387	13
β-strand	391-401	11	3
α-helix	406	1
β-strand	407-413	7	3
α-helix	418-420	3
β-strand	422-425	4	3
α-helix	426-442	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromodomain-helicase-DNA-binding protein 1	A	protein	174	HOMO SAPIENS	O14646 (AlphaFold model)
Lysine-specific histone demethylase 1A	B	protein	12	HOMO SAPIENS	O60341 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AFW_1 CHROMODOMAIN-HELICASE-DNA-BINDING PROTEIN 1 (chains A)
EFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIH
NTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQ
IVERIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQACIDEYFSR

Sequence of entity 2 (B), FASTA

>5AFW_2 LYSINE-SPECIFIC HISTONE DEMETHYLASE 1A (chains B)
RRTSRRKRAKVE

Primary citation

Assembly of Methylated Kdm1A and Chd1 Drives Androgen Receptor-Dependent Transcription and Translocation. Metzger, E., Willmann, D., Mcmillan, J. et al. Nat Struct Mol Biol (2016) 23:132. DOI 10.1038/NSMB.3153 · PubMed

Other PDB entries of the same protein (UniProt O14646 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9F 1.35 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9H 1.45 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9I 1.55 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
4B4C 1.62 Å, Crystal structure of the DNA-binding domain of human CHD1.
9T9E 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
9T9G 1.7 Å, Crystal structure of human CHD1 tandem chromodomain in complex with the…
4O42 1.87 Å, Tandem chromodomains of human CHD1 in complex with influenza NS1 C-terminal tail…
4NW2 1.9 Å, Tandem chromodomains of human CHD1 in complex with Influenza virus NS1 C-terminal tail…
2B2Y 2.35 Å, Tandem chromodomains of human CHD1
2B2W 2.4 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2T 2.45 Å, Tandem chromodomains of human CHD1 complexed with Histone H3 Tail containing…
2B2V 2.65 Å, Crystal structure analysis of human CHD1 chromodomains 1 and 2 bound to histone H3 resi…

Browse structure collections

About this viewer

MolViewer shows 5AFW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.