7JNY: CXCL13

Crystal structure of CXCL13. Determined by X-ray diffraction at 1.88 Å resolution. Released 7 Oct 2020.

Method: X-ray diffraction
Resolution: 1.88 Å
Organism: Homo sapiens
Chains: 1
Atoms: 736
Mol. weight: 10.47 kDa
Released: 7 Oct 2020

Explore 7JNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JNY contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1-4	4	1
α-helix	9-11	3
β-strand	17	1	1
α-helix	23-25	3
β-strand	26-32	7	1
β-strand	42-47	6	1
β-strand	52-55	4	1
α-helix	60-71	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C motif chemokine 13	A	protein	88	Homo sapiens	O43927 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7JNY_1 C-X-C motif chemokine 13 (chains A)
MVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQA
EWIQRMMEVLRKRSSSTLPVPVFKRKIP

Primary citation

The N-terminal length and side-chain composition of CXCL13 affect crystallization, structure and functional activity. Rosenberg Jr., E.M., Herrington, J., Rajasekaran, D. et al. Acta Crystallogr D Struct Biol (2020) 76:1033-1049. DOI 10.1107/S2059798320011687 · PubMed

Other PDB entries of the same protein (UniProt O43927 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CBE 2.4 Å, E10 in complex with CXCL13
5CBA 2.5 Å, 3B4 in complex with CXCL13 - 3B4-CXCL13
6VGJ 2.52 Å, N-terminal variant of CXCL13

Browse structure collections

About this viewer

MolViewer shows 7JNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.