7JTF: RM2-01 Fab heavy chain

Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody RM2-01. Determined by X-ray diffraction at 3.35 Å resolution. Released 10 Mar 2021.

Method: X-ray diffraction
Resolution: 3.35 Å
Organisms: Macaca mulatta, Recombinant Hepatitis C virus HK6a/JFH-1
Chains: 6
Atoms: 8,617
Mol. weight: 136.53 kDa
Released: 10 Mar 2021

Explore 7JTF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JTF contains 46 α-helices and 115 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
β-strand	18-20	3	2
β-strand	33-39	7	1
β-strand	45-46	2	1
β-strand	51	1	3
β-strand	52	1	1
β-strand	58	1	3
β-strand	67-70	4	2
β-strand	79-82	4	2
α-helix	84-86	3
β-strand	88-95	8	1
β-strand	100G-102	3	1
β-strand	107-111	5	1
β-strand	117	1	4
β-strand	120-124	5	5
β-strand	138-145	8	5
β-strand	146	1	4
β-strand	151-154	4	6
α-helix	155-157	3
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-182	7	5
α-helix	186-188	3
β-strand	194-200	7	6
β-strand	205-211	7	6

Chain B: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	7
β-strand	10-11	2	8
β-strand	19-29	11	7
β-strand	33-38	6	8
β-strand	45-48	4	8
β-strand	54	1	8
α-helix	55	1
β-strand	62-75	14	7
β-strand	85-90	6	8
α-helix	96	1
β-strand	97	1	8
α-helix	101	1
β-strand	102-104	3	8
α-helix	111-113	3
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	145-150	6	10
β-strand	154-155	2	10
β-strand	159-160	2	9
β-strand	163	1	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-187	5
β-strand	191-197	7	10
β-strand	206-210	5	10

Chain C: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	17
β-strand	18-20	3	18
β-strand	33-39	7	17
β-strand	46	1	17
β-strand	51	1	19
β-strand	52	1	17
β-strand	58	1	19
α-helix	61-63	3
β-strand	67-70	4	18
β-strand	79-82	4	18
α-helix	84-86	3
β-strand	88-95	8	17
β-strand	100G-102	3	17
β-strand	107-111	5	17
α-helix	114-116	3
β-strand	117	1	20
β-strand	120-124	5	21
β-strand	137-145	9	21
β-strand	146	1	20
β-strand	151-154	4	22
α-helix	155-157	3
β-strand	159	1	22
β-strand	163-165	3	21
α-helix	166-168	3
β-strand	169-170	2	21
β-strand	176-183	8	21
α-helix	187-190	4
β-strand	194-200	7	22
α-helix	201-203	3
β-strand	205-211	7	22

Chain D: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	23
β-strand	10-13	4	24
β-strand	19-25	7	23
β-strand	33-38	6	24
β-strand	45-48	4	24
β-strand	54	1	24
α-helix	55	1
β-strand	62-67	6	23
β-strand	70-75	6	23
α-helix	80-82	3
β-strand	85-90	6	24
α-helix	96	1
β-strand	97-98	2	24
β-strand	102-106	5	24
α-helix	107	1
β-strand	111	1	25
α-helix	112-113	2
β-strand	114-118	5	26
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	26
β-strand	140	1	25
β-strand	145-150	6	27
β-strand	154-155	2	27
β-strand	159-160	2	26
β-strand	163	1	26
α-helix	164-167	4
β-strand	173-182	10	26
α-helix	183-188	6
β-strand	191-197	7	27
β-strand	206-210	5	27

Chain E: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	426-427	2	11
α-helix	439-442	4
α-helix	492-494	3
β-strand	496-498	3	12
α-helix	499-501	3
β-strand	503-504	2	11
β-strand	506-509	4	13
β-strand	513-516	4	13
β-strand	519	1	12
α-helix	524	1
β-strand	525	1	12
α-helix	526	1
β-strand	536-538	3	12
α-helix	540-542	3
β-strand	552-555	4	13
β-strand	561-564	4	13
β-strand	609	1	14
α-helix	614-617	4
α-helix	619-621	3
α-helix	624	1
β-strand	625	1	15
α-helix	626	1
β-strand	628-633	6	16
β-strand	636-641	6	16
β-strand	642	1	14
β-strand	644	1	15

Chain F: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	422-424	3
β-strand	426-427	2	28
α-helix	439-442	4
α-helix	492-494	3
β-strand	496-498	3	29
α-helix	499-501	3
β-strand	503-504	2	28
β-strand	506-509	4	30
β-strand	513-516	4	30
β-strand	519	1	29
β-strand	525	1	29
β-strand	536-538	3	29
α-helix	539-542	4
β-strand	552-555	4	30
β-strand	561-563	3	30
β-strand	609	1	31
α-helix	614-617	4
α-helix	619-621	3
α-helix	624	1
β-strand	625-633	9	31
β-strand	636-644	9	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RM2-01 Fab heavy chain	A, C	protein	229	Macaca mulatta
RM2-01 Fab light chain	B, D	protein	214	Macaca mulatta
Envelope glycoprotein E2	E, F	protein	189	Recombinant Hepatitis C virus HK6a/JFH-1	B9V0E2

Sequence of entity 1 (A, C), FASTA

>7JTF_1 RM2-01 Fab heavy chain (chains A, C)
QVQLVQSGAEVKKPGASVKLSCKASGFTFRIYAISWVRQAPGQGLEWMGEIVPLGGITNY
AQNFQGRAAITADTSINTAYMELSSLRSDDTAVYYCARVRTALVGPREGIFDFWGQGVLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGS

Sequence of entity 2 (B, D), FASTA

>7JTF_2 RM2-01 Fab light chain (chains B, D)
DIQMTQSPSSLSASVGDRVSITCRASQTISTYLAWYQQKPGKVPKLLIYTASTLETGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCQQHDSHPYSFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (E, F), FASTA

>7JTF_3 Envelope glycoprotein E2 (chains E, F)
QLINTNGSWHINRTALNCNDSLQTGFITSLFYAKNVDSSGCPERMAACGSSGCWHYAPRP
CDVVSARTVCGPVYCFTPSPVVVGTTDKLGIPTYNWGENETDVFMLESLRPPTGGWFGCT
WMNSTGFTKTCGAPPGGPTDGGSGPWITPRCLVDYPYRLWHYPCTVNFTLHKVRMFVGGI
EHRFDAACN

Primary citation

HCV Env immunization elicits a rapid VH1-69-like broadly neutralizing antibody response in rhesus macaques. Tzarum, N., Chen, F., Lin, X. et al. Immunity (2021).

Other PDB entries of the same protein (UniProt B9V0E2), best resolution first:

6UYF 2.06 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2mc3-v1 redesigned core from…
6WO4 2.35 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6WO3 2.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKC 2.6 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
7JTG 2.6 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6BKB 2.8 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
9MNS 2.89 Å, Structure of Hepatitis C virus envelope glycoprotein E2 core from genotype 6a bound to…
6BKD 3.25 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to…
6UYG 3.38 Å, Structure of Hepatitis C Virus Envelope Glycoprotein E2c3 core from genotype 6a bound to…

Browse structure collections

About this viewer

MolViewer shows 7JTF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.