7JTN: Complement factor B

Human Complement Factor B Inhibited by a Slow Off-Rate Modified Aptamer of 29 Bases. Determined by X-ray diffraction at 3.1 Å resolution. Released 9 Dec 2020.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 12,542
Mol. weight: 192.81 kDa
Released: 9 Dec 2020

Explore 7JTN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JTN contains 51 α-helices and 106 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	19-20	2	1
β-strand	23-27	5	2
α-helix	28-30	3
β-strand	32-36	5	2
β-strand	41-44	4	1
β-strand	48-50	3	2
β-strand	51	1	3
β-strand	57	1	3
α-helix	58-59	2
β-strand	60	1	4
β-strand	68	1	4
β-strand	71-75	5	1
β-strand	78	1	5
α-helix	79-81	3
β-strand	87-90	4	6
β-strand	96	1	5
β-strand	101-106	6	6
β-strand	111-113	3	7
β-strand	117-119	3	6
β-strand	120	1	8
β-strand	126	1	8
β-strand	132-134	3	7
β-strand	149-152	4	9
β-strand	161-166	6	9
β-strand	171-173	3	10
β-strand	177-179	3	9
β-strand	180	1	11
β-strand	186	1	11
β-strand	192-194	3	10
α-helix	202-210	9
β-strand	211	1	12
β-strand	214	1	12
β-strand	215-216	2	13
β-strand	234-235	2	13
β-strand	243-251	9	14
α-helix	255-257	3
α-helix	262-276	15
β-strand	283-289	7	14
β-strand	293-297	5	14
α-helix	307-314	8
β-strand	329	1	15
α-helix	331-341	11
α-helix	348-349	2
α-helix	352-354	3
β-strand	355-363	9	14
β-strand	369	1	15
α-helix	374-383	10
α-helix	395-397	3
β-strand	398-405	8	14
α-helix	411-417	7
β-strand	427-430	4	14
α-helix	433-444	12
α-helix	445-447	3
β-strand	471-476	6	16
β-strand	484-489	6	16
β-strand	495-498	4	16
α-helix	500-502	3
β-strand	512-516	5	16
α-helix	521-523	3
β-strand	525-530	6	16
α-helix	531	1
β-strand	553-557	5	16
β-strand	571	1	17
β-strand	575	1	18
α-helix	576-581	6
α-helix	590-597	8
β-strand	604-611	8	17
β-strand	614-622	9	17
α-helix	628-633	6
α-helix	634-637	4
α-helix	647-649	3
β-strand	655-659	5	17
α-helix	666-670	5
β-strand	677-682	6	17
β-strand	685-695	11	17
β-strand	714-719	6	17
α-helix	724-730	7
β-strand	738	1	18

Chain C: 26 helices, 53 β-strands

Element	Residues	Length	Sheet
β-strand	19-20	2	19
β-strand	23-27	5	20
β-strand	32-36	5	20
β-strand	41-44	4	19
β-strand	48-50	3	20
β-strand	51	1	21
β-strand	57	1	21
α-helix	58-59	2
β-strand	60	1	22
β-strand	68	1	22
β-strand	71-75	5	19
β-strand	78	1	23
α-helix	79-81	3
β-strand	87-90	4	24
β-strand	96	1	23
β-strand	101-106	6	24
β-strand	111-113	3	25
β-strand	117-119	3	24
β-strand	120	1	26
β-strand	126	1	26
β-strand	132-134	3	25
β-strand	149-152	4	27
β-strand	161-166	6	27
β-strand	171-173	3	28
β-strand	177-179	3	27
β-strand	180	1	29
β-strand	186	1	29
β-strand	192-194	3	28
α-helix	202-210	9
β-strand	211	1	30
β-strand	214	1	30
β-strand	215-216	2	31
β-strand	234-235	2	31
β-strand	243-251	9	32
α-helix	255-257	3
α-helix	262-276	15
β-strand	283-289	7	32
β-strand	293-297	5	32
α-helix	307-314	8
β-strand	329	1	33
α-helix	331-341	11
α-helix	348-349	2
α-helix	352-354	3
β-strand	355-363	9	32
β-strand	369	1	33
α-helix	374-383	10
α-helix	395-397	3
β-strand	398-405	8	32
α-helix	411-417	7
β-strand	427-430	4	32
α-helix	433-444	12
α-helix	445-447	3
α-helix	464-467	4
β-strand	471-476	6	34
α-helix	482-483	2
β-strand	484-489	6	34
β-strand	495-498	4	34
α-helix	500-502	3
β-strand	512-516	5	34
α-helix	521-523	3
β-strand	525-530	6	34
α-helix	531	1
β-strand	553-557	5	34
β-strand	571	1	35
β-strand	575	1	36
α-helix	576-581	6
α-helix	590-597	8
β-strand	604-611	8	35
β-strand	614-622	9	35
α-helix	628-633	6
α-helix	634-637	4
α-helix	647-649	3
β-strand	655-659	5	35
α-helix	666-670	5
β-strand	677-682	6	35
β-strand	685-695	11	35
β-strand	714-719	6	35
α-helix	724-730	7
β-strand	738	1	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor B	A, C	protein	764	Homo sapiens	P00751 (AlphaFold model)
DNA (30-mer)	B, D	DNA	30	synthetic construct

Sequence of entity 1 (A, C), FASTA

>7JTN_1 Complement factor B (chains A, C)
MGSNLSPQLCLMPFILGLLSGGVTTTPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEY
VCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPY
YNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQ
YRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTE
TIEGVDAEDGHGPGEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKCLVNLIEKV
ASYGVKPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQ
AVYSMMSWPDDVPPEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPRE
DYLDVYVFGVGPLVNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGM
VWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVS
VGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYGQTIRPICLPCT
EGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDA
QYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWG
VVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL

Sequence of entity 2 (B, D), FASTA

>7JTN_2 DNA (30-MER) (chains B, D)
GCXGAGAAXAGAAGXAGGAGXAXGCXXGCT

Primary citation

Inhibition of the Complement Alternative Pathway by Chemically Modified DNA Aptamers That Bind with Picomolar Affinity to Factor B. Xu, X., Zhang, C., Denton, D.T. et al. J Immunol (2021) 206:861-873. DOI 10.4049/jimmunol.2001260 · PubMed

Other PDB entries of the same protein (UniProt P00751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QSW 1.64 Å, Complement factor B protease domain in complex with the reversible inhibitor…
6RAV 1.7 Å, Complement factor B protease domain in complex with the reversible inhibitor…
6T8W 1.7 Å, Complement factor B in complex with (-)-4-(1-((5,7-Dimethyl-1H-indol-4-yl)methyl)piperidi…
6QSX 1.77 Å, Complement factor B protease domain in complex with the reversible inhibitor…
1Q0P 1.8 Å, A domain of Factor B
1RRK 2.0 Å, Crystal Structure Analysis of the Bb segment of Factor B
1DLE 2.1 Å, Factor B serine protease domain
3HRZ 2.2 Å, Cobra Venom Factor (CVF) in complex with human factor B
6T8V 2.29 Å, Complement factor B in complex with (S)-5,7-Dimethyl-4-((2-phenylpiperidin-1-yl)methyl)-1…
1RTK 2.3 Å, Crystal Structure Analysis of the Bb segment of Factor B complexed with…
2OK5 2.3 Å, Human Complement factor B
1RS0 2.6 Å, Crystal Structure Analysis of the Bb segment of Factor B complexed with…

Browse structure collections

About this viewer

MolViewer shows 7JTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.