7K27: Tandem bromodomain (BD1, BD2) of human TAF1

Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR inhibitor AZ20. Determined by X-ray diffraction at 1.5 Å resolution. Released 22 Sept 2021.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,364
Mol. weight: 31.8 kDa
Ligands: VCD
Released: 22 Sept 2021

Explore 7K27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7K27 contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	1381-1397	17
α-helix	1403-1405	3
α-helix	1417-1420	4
α-helix	1427-1435	9
α-helix	1442-1459	18
α-helix	1465-1483	19
α-helix	1485-1495	11
α-helix	1497-1500	4
α-helix	1502-1513	12
α-helix	1514-1519	6
α-helix	1526-1528	3
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1606	19
α-helix	1608-1624	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A	protein	265	Homo sapiens	P21675 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7K27_1 Transcription initiation factor TFIID subunit 1 (chains A)
SMSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTL
RENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLAR
LEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDL
ETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEH
LTQLEKDICTAKEAALEEAELESLD

Ligands and cofactors

ID	Name	Formula	Copies
VCD	4-{4-[(3R)-3-methylmorpholin-4-yl]-6-[1-(methylsulfonyl)cyclopropyl]pyrimidin-2…	C21 H24 N4 O3 S	1

Water and common crystallization additives (EDO, DMS, GOL) are not listed.

Primary citation

Discovery of Dual TAF1-ATR Inhibitors and Ligand-Induced Structural Changes of the TAF1 Tandem Bromodomain. Karim, R.M., Yang, L., Chen, L. et al. J Med Chem (2022) 65:4182-4200. DOI 10.1021/acs.jmedchem.1c01999 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589
5MG2 1.75 Å, Crystal structure of the second bromodomain of human TAF1 in complex with BAY-299…

Browse structure collections

About this viewer

MolViewer shows 7K27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.