7KE3: PDB entry 7KE3

Heavy chain ferritin with C-terminal EBNA1 epitope. Determined by X-ray diffraction at 2.2 Å resolution. Released 1 Sept 2021.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Epstein-Barr virus (strain B95-8)
Chains: 12
Atoms: 17,042
Mol. weight: 283.98 kDa
Ligands: FE
Released: 1 Sept 2021

Explore 7KE3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KE3 contains 84 α-helices and 12 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, D, E, F, H, I, J, K and L: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	14-41	28
α-helix	49-75	27
β-strand	85	1	1
α-helix	96-123	28
α-helix	127-133	7
α-helix	134-138	5
α-helix	139-158	20
α-helix	164-173	10

Chains C and G: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	14-41	28
α-helix	49-76	28
β-strand	85	1	2
α-helix	96-123	28
α-helix	127-133	7
α-helix	134-138	5
α-helix	139-158	20
α-helix	164-173	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain,Epstein-Barr nuclear antigen 1	A, B, C, D, E, F, G, H, I, J, K, L	protein	209	Homo sapiens, Epstein-Barr virus (strain B95-8)	P02794 (AlphaFold model), P03211 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA

>7KE3_1 Ferritin heavy chain,Epstein-Barr nuclear antigen 1 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK
LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD
NESGGSGGGGSGGGGSGGHPVGEADYFEY

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	20

Water and common crystallization additives (TRS) are not listed.

Primary citation

Immunogenicity study of engineered ferritins with C- and N-terminus insertion of Epstein-Barr nuclear antigen 1 epitope. Qu, Y., Zhang, B., Wang, Y. et al. Vaccine (2021) 39:4830-4841. DOI 10.1016/j.vaccine.2021.07.021 · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
7A6A 1.15 Å, 1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…

Browse structure collections

About this viewer

MolViewer shows 7KE3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.