7KPI: SPOP MATH domain

Crystal structure of the SPOP MATH domain. Determined by X-ray diffraction at 1.7 Å resolution. Released 28 Apr 2021.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,335
Mol. weight: 16.35 kDa
Released: 28 Apr 2021

Explore 7KPI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KPI contains 6 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	1
β-strand	31-38	8	2
α-helix	41-43	3
β-strand	52-53	2	3
α-helix	54-56	3
β-strand	57-59	3	3
β-strand	60-61	2	1
β-strand	65-72	8	3
α-helix	78-80	3
β-strand	83-92	10	3
β-strand	97-107	11	2
β-strand	113-118	6	2
β-strand	123-126	4	2
β-strand	130-138	9	3
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A	protein	142	Homo sapiens	D6RDG8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7KPI_1 Speckle-type POZ protein (chains A)
GPGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYL
SLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLD
EANGLLPDDKLTLFCEVSVVQD

Primary citation

Intrinsically disordered substrates dictate SPOP subnuclear localization and ubiquitination activity. Usher, E.T., Sabri, N., Rohac, R. et al. J Biol Chem (2021) 296:100693-100693. DOI 10.1016/j.jbc.2021.100693 · PubMed

Other PDB entries of the same protein (UniProt D6RDG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HFU 1.7 Å, Caprin1 peptide bound to SPOP MATH domain
9HFW 1.7 Å, SRC-3 (NCoA-3) peptide bound to SPOP MATH domain
7KPK 1.71 Å, Crystal structure of the SPOP MATH domain in complex with a fragment of Pdx1
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 7KPI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.