7KPK: SPOP MATH domain

Crystal structure of the SPOP MATH domain in complex with a fragment of Pdx1. Determined by X-ray diffraction at 1.71 Å resolution. Released 28 Apr 2021.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,238
Mol. weight: 18.42 kDa
Released: 28 Apr 2021

Explore 7KPK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KPK contains 4 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	1
β-strand	31-38	8	2
β-strand	52-53	2	3
α-helix	54-56	3
β-strand	57-59	3	3
β-strand	60-61	2	1
β-strand	65-72	8	3
β-strand	83-92	10	3
β-strand	98-107	10	2
β-strand	113-118	6	2
β-strand	123-125	3	2
β-strand	130-138	9	3
α-helix	139-143	5
α-helix	145-147	3
α-helix	151-153	3
β-strand	155-163	9	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Speckle-type POZ protein	A	protein	142	Homo sapiens	D6RDG8 (AlphaFold model)
Pdx1 peptide	B	protein	19	Homo sapiens	P52945 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7KPK_1 Speckle-type POZ protein (chains A)
GPGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYL
SLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLD
EANGLLPDDKLTLFCEVSVVQD

Sequence of entity 2 (B), FASTA

>7KPK_2 Pdx1 peptide (chains B)
LSASPQPSSVAPRRPQEPR

Primary citation

Intrinsically disordered substrates dictate SPOP subnuclear localization and ubiquitination activity. Usher, E.T., Sabri, N., Rohac, R. et al. J Biol Chem (2021) 296:100693-100693. DOI 10.1016/j.jbc.2021.100693 · PubMed

Other PDB entries of the same protein (UniProt D6RDG8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7KPI 1.7 Å, Crystal structure of the SPOP MATH domain
9HFU 1.7 Å, Caprin1 peptide bound to SPOP MATH domain
9HFW 1.7 Å, SRC-3 (NCoA-3) peptide bound to SPOP MATH domain
9HGH 1.9 Å, MyD88 peptide_1 bound to SPOP MATH domain

Browse structure collections

About this viewer

MolViewer shows 7KPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.