7KW7: Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR

Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR. Determined by electron microscopy at 3.57 Å resolution. Released 8 Dec 2021.

Method: Electron microscopy
Resolution: 3.57 Å
Organism: Homo sapiens
Chains: 6
Atoms: 21,852
Mol. weight: 459.24 kDa
Ligands: ADP, MG
Released: 8 Dec 2021

Explore 7KW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KW7 contains 147 α-helices and 112 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
α-helix	22-23	2
α-helix	24-35	12
α-helix	43-62	20
α-helix	67-70	4
β-strand	78-83	6	1
α-helix	84-86	3
β-strand	88-93	6	1
α-helix	100-104	5
α-helix	106-108	3
α-helix	111-123	13
α-helix	128-134	7
α-helix	137-143	7
β-strand	145-153	9	1
β-strand	160-164	5	1
β-strand	169-174	6	1
β-strand	183-190	8	1
α-helix	192-198	7
α-helix	200-210	11
β-strand	218-222	5	1
β-strand	286-289	4	1
α-helix	296-298	3
α-helix	306-317	12
β-strand	323-331	9	2
β-strand	332-333	2	3
β-strand	337-344	8	2
α-helix	350-352	3
α-helix	357-360	4
β-strand	361-365	5	2
β-strand	368-371	4	2
α-helix	380-382	3
β-strand	386-391	6	2
α-helix	400-404	5
α-helix	407-428	22
α-helix	431-451	21
α-helix	453-455	3
α-helix	456-460	5
β-strand	464-465	2	4
β-strand	466-467	2	5
β-strand	475-476	2	4
α-helix	477-481	5
α-helix	484-485	2
β-strand	490-495	6	5
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-513	5
β-strand	518-521	4	5
α-helix	526-532	7
β-strand	535-536	2	5
β-strand	539-543	5	5
β-strand	546	1	6
α-helix	555-567	13
α-helix	569-578	10
β-strand	585-588	4	6
β-strand	597-601	5	6
α-helix	602	1
α-helix	608-617	10
α-helix	623-629	7
β-strand	632-636	5	6
α-helix	641-652	12
α-helix	657-673	17
α-helix	676-678	3
α-helix	681-695	15

Chain B: 36 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	18-19	2	7
α-helix	24-34	11
α-helix	43-65	23
α-helix	67-70	4
β-strand	71	1	8
β-strand	73	1	8
β-strand	78-83	6	7
β-strand	88-93	6	7
α-helix	100-104	5
α-helix	106-108	3
α-helix	111-123	13
α-helix	128-134	7
α-helix	137-143	7
β-strand	145-153	9	7
β-strand	159-164	6	7
β-strand	170-174	5	7
α-helix	178-180	3
β-strand	183-190	8	7
α-helix	192-198	7
α-helix	200-210	11
β-strand	218-222	5	7
β-strand	286-289	4	7
α-helix	296-298	3
α-helix	306-317	12
α-helix	322	1
β-strand	323-331	9	9
β-strand	332-333	2	10
β-strand	337-344	8	9
α-helix	347-349	3
α-helix	352-355	4
β-strand	361-365	5	9
β-strand	368-371	4	9
α-helix	380-382	3
β-strand	386-391	6	9
α-helix	400-404	5
α-helix	407-429	23
α-helix	431-451	21
α-helix	456-460	5
β-strand	464-465	2	11
β-strand	466-467	2	12
β-strand	475-476	2	11
α-helix	477-481	5
α-helix	484-485	2
β-strand	490-495	6	12
α-helix	499-503	5
α-helix	506-508	3
α-helix	509-513	5
β-strand	518-521	4	12
α-helix	526-532	7
β-strand	535-536	2	12
β-strand	539-543	5	12
β-strand	546	1	13
α-helix	555-567	13
α-helix	569-578	10
β-strand	585-588	4	13
β-strand	597-601	5	13
α-helix	602	1
α-helix	608-620	13
α-helix	628-631	4
β-strand	632-636	5	13
α-helix	641-652	12
α-helix	657-673	17
α-helix	676-678	3
α-helix	681-696	16

Chain C: 25 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	14
β-strand	15-22	8	14
β-strand	25-28	4	14
β-strand	37-39	3	14
β-strand	41-44	4	15
β-strand	49-51	3	15
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-68	3	15
α-helix	70-72	3
α-helix	81-87	7
β-strand	93-95	3	16
β-strand	102-107	6	16
β-strand	110-114	5	16
α-helix	115	1
α-helix	116-135	20
β-strand	141-146	6	14
α-helix	152-164	13
β-strand	168-174	7	14
α-helix	175-182	8
β-strand	193-200	8	3
β-strand	205-213	9	3
β-strand	216-225	10	3
α-helix	230-249	20
α-helix	253-255	3
α-helix	257-276	20
β-strand	279-288	10	17
β-strand	291-298	8	17
α-helix	299-305	7
α-helix	307-311	5
α-helix	312-314	3
α-helix	315-324	10
α-helix	328-330	3
β-strand	333-337	5	3
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	3
α-helix	368-380	13
α-helix	389-394	6
β-strand	396	1	18
β-strand	401-405	5	19
β-strand	409-414	6	19
β-strand	419	1	18
β-strand	422-428	7	20
β-strand	429-430	2	21
β-strand	437-444	8	19
β-strand	449	1	19
α-helix	450-452	3
β-strand	454-462	9	19
α-helix	464-466	3
β-strand	474-480	7	20
β-strand	486-492	7	20
β-strand	497-503	7	20
α-helix	504-505	2
α-helix	636-638	3

Chain D: 18 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	22
β-strand	15-22	8	22
β-strand	25-28	4	22
α-helix	29-30	2
β-strand	37-39	3	22
β-strand	42-44	3	23
β-strand	49-51	3	23
α-helix	53-56	4
α-helix	63-65	3
β-strand	66-67	2	23
α-helix	70-73	4
α-helix	81-86	6
α-helix	87-89	3
β-strand	93-96	4	24
β-strand	101-107	7	24
β-strand	110-114	5	24
α-helix	116-135	20
β-strand	141-146	6	22
α-helix	152-165	14
β-strand	168-174	7	22
α-helix	175-182	8
β-strand	194-200	7	10
β-strand	205-213	9	10
β-strand	216-225	10	10
α-helix	231-249	19
α-helix	257-273	17
β-strand	279-288	10	25
β-strand	291-298	8	25
α-helix	299-305	7
α-helix	307-312	6
α-helix	315-323	9
β-strand	333-337	5	10
α-helix	339-342	4
α-helix	344-353	10
α-helix	357-359	3
β-strand	360	1	10
α-helix	368-380	13

Chain E: 19 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	220-237	18
α-helix	241-254	14
α-helix	259-272	14
α-helix	275-291	17
α-helix	296-312	17
α-helix	316-329	14
α-helix	333-354	22
α-helix	357-371	15
α-helix	376-389	14
α-helix	394-406	13
α-helix	410-423	14
α-helix	428-440	13
α-helix	444-457	14
α-helix	462-477	16
α-helix	482-489	8
α-helix	493-500	8
α-helix	502-513	12
α-helix	515-521	7
α-helix	525-536	12
β-strand	541-542	2	26

Chain F: 12 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	520	1	19
β-strand	522-523	2	21
β-strand	530-531	2	26
α-helix	533-538	6
α-helix	559-579	21
α-helix	584-586	3
α-helix	589-616	28
β-strand	622-624	3	27
β-strand	627-628	2	27
α-helix	631-634	4
α-helix	637-656	20
α-helix	660-671	12
β-strand	674-676	3	28
α-helix	683-705	23
α-helix	709-741	33
α-helix	743-745	3
α-helix	751-764	14
β-strand	769-771	3	28
α-helix	772	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heat shock protein HSP 90-alpha	A, B	protein	732	Homo sapiens	P07900 (AlphaFold model)
Heat shock 70 kDa protein 1A	C, D	protein	641	Homo sapiens	P0DMV8 (AlphaFold model)
Stress-induced-phosphoprotein 1	E	protein	543	Homo sapiens	P31948 (AlphaFold model)
Glucocorticoid receptor	F	protein	777	Homo sapiens	P04150 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7KW7_1 Heat shock protein HSP 90-alpha (chains A, B)
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLE
GDDDTSRMEEVD

Sequence of entity 2 (C, D), FASTA

>7KW7_2 Heat shock 70 kDa protein 1A (chains C, D)
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD

Sequence of entity 3 (E), FASTA

>7KW7_3 Stress-induced-phosphoprotein 1 (chains E)
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
VLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR

Sequence of entity 4 (F), FASTA

>7KW7_4 Glucocorticoid receptor (chains F)
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
VKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGN
SNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKSIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MSLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
MG	Magnesium ion	Mg	2

Water and common crystallization additives (K) are not listed.

Primary citation

Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism. Wang, R.Y., Noddings, C.M., Kirschke, E. et al. Nature (2022) 601:460-464. DOI 10.1038/s41586-021-04252-1 · PubMed

Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TN5 1.17 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
5J80 1.17 Å, Crystal Structure of Apo Hsp90-alpha N-domain L107A mutant
3T0H 1.2 Å, Structure insights into mechanisms of ATP hydrolysis and the activation of human Hsp90
5J2X 1.22 Å, Crystal Structure of Hsp90-alpha N-domain in complex with…
3T10 1.24 Å, HSP90 N-terminal domain bound to ACP
6TN4 1.27 Å, Rapid optimisation of fragments and hits to lead compounds from screening of crude…
3WHA 1.3 Å, Hsp90 alpha N-terminal domain in complex with a tricyclic inhibitor
5XRD 1.3 Å, Crystal Structure of the human Hsp90-alpha N-domain bound to the hsp90 inhibitor FS7
2YK9 1.32 Å, Tricyclic series of Hsp90 inhibitors
5LRL 1.33 Å, Crystal structure of HSP90 in complex with A003492875
6GR5 1.34 Å, Structure of human Heat shock protein 90-alpha N-terminal domain (Hsp90-NTD) variant…
3B28 1.35 Å, Hsp90 alpha N-terminal domain in complex with an inhibitor CH5015765

Browse structure collections

About this viewer

MolViewer shows 7KW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.