7LC1: KRAS4b

Crystal Structure of KRAS4b (GMPPNP-bound) in complex with the RBD-PH domains of SIN1. Determined by X-ray diffraction at 2.35 Å resolution. Released 4 Aug 2021.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,057
Mol. weight: 93.56 kDa
Ligands: GNP, MG
Released: 4 Aug 2021

Explore 7LC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LC1 contains 28 α-helices and 41 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
α-helix	16-25	10
β-strand	37-46	10	1
β-strand	49-58	10	1
α-helix	62-67	6
α-helix	68-74	7
β-strand	77-83	7	1
α-helix	87-91	5
α-helix	93-103	11
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
β-strand	145	1	2
β-strand	150	1	2
α-helix	152-166	15

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	279-285	7	1
β-strand	288-294	7	1
β-strand	300	1	3
α-helix	301-313	13
β-strand	323-327	5	1
β-strand	340	1	3
β-strand	348-353	6	1
α-helix	358-360	3
α-helix	369-370	2
α-helix	371-378	8
β-strand	384-392	9	4
β-strand	396-404	9	4
β-strand	408-413	6	4
α-helix	425-429	5
β-strand	430-433	4	4
α-helix	434-436	3
β-strand	437-447	11	4
β-strand	450-458	9	4
β-strand	463-470	8	4
α-helix	472-486	15
α-helix	493-499	7

Chain C: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	5
α-helix	16-25	10
β-strand	37-46	10	5
β-strand	49-58	10	5
α-helix	59	1
α-helix	62-67	6
α-helix	68-74	7
β-strand	77-83	7	5
α-helix	87-103	17
β-strand	111-116	6	5
α-helix	127-137	11
β-strand	141-143	3	5
α-helix	152-164	13

Chain D: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	279-285	7	5
β-strand	288-294	7	5
β-strand	300	1	6
α-helix	301-313	13
β-strand	323-327	5	5
α-helix	333	1
β-strand	334	1	5
α-helix	335	1
β-strand	340	1	6
β-strand	348-353	6	5
α-helix	369-370	2
α-helix	371-378	8
β-strand	384-392	9	7
β-strand	396-404	9	7
β-strand	408-413	6	7
β-strand	430-433	4	7
β-strand	437-447	11	7
β-strand	450-458	9	7
β-strand	463-470	8	7
α-helix	472-487	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2B of GTPase KRas	A, C	protein	170	Homo sapiens	P01116 (AlphaFold model)
Target of rapamycin complex 2 subunit MAPKAP1	B, D	protein	237	Homo sapiens	Q9BPZ7 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7LC1_1 Isoform 2B of GTPase KRas (chains A, C)
GMTEYKLVVVGAGGVGKSALTIQLIANHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA
GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCD
LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Sequence of entity 2 (B, D), FASTA

>7LC1_2 Target of rapamycin complex 2 subunit MAPKAP1 (chains B, D)
GSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNV
AVDLDSTLESQSAWEFCLVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHR
LRFTTDVQLGISGDKVEIDPVTNQKASTKFWIKQKPISIDSDLLCACDLAEEKSPSHAIF
KLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRASTARADYFAQKQRKLNRRTS

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2
MG	Magnesium ion	Mg	2

Primary citation

RAS interaction with Sin1 is dispensable for mTORC2 assembly and activity. Castel, P., Dharmaiah, S., Sale, M.J. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2103261118 · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse structure collections

About this viewer

MolViewer shows 7LC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.