7LC2: KRAS4b-Q61R

Crystal Structure of KRAS4b-Q61R (GMPPNP-bound) in complex with the RAS-binding domain (RBD) of SIN1. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,833
Mol. weight: 59.83 kDa
Ligands: MG, GNP
Released: 28 Jul 2021

Explore 7LC2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LC2 contains 17 α-helices and 29 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1	1
β-strand	2-10	9	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	62-67	6
α-helix	68-71	4
β-strand	77-83	7	1
α-helix	87-103	17
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
β-strand	145	1	2
β-strand	150	1	2
α-helix	152-163	12

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	3
α-helix	16-24	9
β-strand	37-45	9	3
β-strand	50-58	9	3
α-helix	62-67	6
α-helix	68-74	7
β-strand	77-83	7	3
α-helix	87-91	5
α-helix	93-103	11
β-strand	111-116	6	3
α-helix	127-137	11
β-strand	141-143	3	3
β-strand	145	1	4
β-strand	150	1	4
α-helix	152-164	13

Chain D: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	280-284	5	3
β-strand	289-293	5	3
β-strand	300	1	5
α-helix	301-313	13
β-strand	323-327	5	3
β-strand	334	1	3
β-strand	340	1	5
α-helix	341-343	3
β-strand	348-353	6	3

Chain E: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	280-285	6	1
β-strand	288-293	6	1
β-strand	300	1	6
α-helix	301-312	12
β-strand	323-327	5	1
β-strand	340	1	6
β-strand	348-353	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase KRas	A, B	protein	170	Homo sapiens	P01116 (AlphaFold model)
Target of rapamycin complex 2 subunit MAPKAP1	D, E	protein	88	Homo sapiens	Q9BPZ7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7LC2_1 GTPase KRas (chains A, B)
GMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA
GREEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCD
LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Sequence of entity 2 (D, E), FASTA

>7LC2_2 Target of rapamycin complex 2 subunit MAPKAP1 (chains D, E)
GSKESLFVRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNV
AVDLDSTLESQSAWEFCLVRENSSRADG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	2

Primary citation

RAS interaction with Sin1 is dispensable for mTORC2 assembly and activity. Castel, P., Dharmaiah, S., Sale, M.J. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2103261118 · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse structure collections

About this viewer

MolViewer shows 7LC2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.