7LFC: Importin a3

Structure of importin a3 bound to p50 NLS. Determined by X-ray diffraction at 2.1 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,371
Mol. weight: 59.73 kDa
Released: 19 Jan 2022

Explore 7LFC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LFC contains 33 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-100	16
α-helix	107-113	7
α-helix	115-122	8
α-helix	129-143	15
α-helix	147-155	9
α-helix	158-165	8
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-205	5
α-helix	214-228	15
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-269	14
α-helix	274-282	9
α-helix	286-289	4
α-helix	290-294	5
α-helix	298-312	15
α-helix	316-323	8
α-helix	327-330	4
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-395	14
α-helix	401-409	9
α-helix	413-417	5
α-helix	418-421	4
α-helix	425-440	16
α-helix	443-445	3
α-helix	446-456	11
α-helix	458-465	8
α-helix	471-484	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A	protein	521	Homo sapiens	O00629 (AlphaFold model)
Nuclear factor NF-kappa-B p105 subunit	B	protein	14	Homo sapiens	P19838 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7LFC_1 Importin subunit alpha-3 (chains A)
MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDS
DIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
HCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETI
QEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLL
TVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEI
IDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B), FASTA

>7LFC_2 Nuclear factor NF-kappa-B p105 subunit (chains B)
DKEEVQRKRQKLMP

Primary citation

Differential recognition of canonical NF-kappa B dimers by Importin alpha 3. Florio, T.J., Lokareddy, R.K., Yeggoni, D.P. et al. Nat Commun (2022) 13:1207-1207. DOI 10.1038/s41467-022-28846-z · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7RFY 2.5 Å, Importin alpha3 in complex with MERS ORF4B
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 7LFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.