7RFY: Importin alpha3

Importin alpha3 in complex with MERS ORF4B. Determined by X-ray diffraction at 2.5 Å resolution. Released 28 Jul 2021.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Homo sapiens, Middle East respiratory syndrome-related coronavirus
Chains: 2
Atoms: 3,143
Mol. weight: 53.04 kDa
Released: 28 Jul 2021

Explore 7RFY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RFY contains 32 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	73-80	8
α-helix	85-99	15
α-helix	107-112	6
α-helix	115-123	9
α-helix	129-142	14
α-helix	147-155	9
α-helix	158-165	8
α-helix	171-185	15
α-helix	189-197	9
α-helix	201-206	6
α-helix	214-229	16
α-helix	234-236	3
α-helix	237-250	14
α-helix	256-270	15
α-helix	274-283	10
α-helix	286-289	4
α-helix	291-294	4
α-helix	298-312	15
α-helix	316-324	9
α-helix	328-330	3
α-helix	331-335	5
α-helix	340-354	15
α-helix	358-366	9
α-helix	370-379	10
α-helix	382-397	16
α-helix	401-409	9
α-helix	413-418	6
α-helix	419-421	3
α-helix	425-441	17
α-helix	471-480	10
α-helix	481-485	5

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-3	A	protein	459	Homo sapiens	O00629 (AlphaFold model)
ORF4b	B	protein	21	Middle East respiratory syndrome-related coronavirus	K9N643

Sequence of entity 1 (A), FASTA

>7RFY_1 Importin subunit alpha-3 (chains A)
SGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHC
LERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALG
NIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQE
ILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQT
AALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQ
AVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTV
KDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIID
QFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

Sequence of entity 2 (B), FASTA

>7RFY_2 ORF4b (chains B)
RKARKRSHSPTKKLRYVKRRF

Primary citation

MERS-CoV ORF4b employs an unusual binding mechanism to target IMP alpha and block innate immunity. Munasinghe, T.S., Edwards, M.R., Tsimbalyuk, S. et al. Nat Commun (2022) 13:1604-1604. DOI 10.1038/s41467-022-28851-2 · PubMed

Other PDB entries of the same protein (UniProt O00629 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BW9 1.6 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 1
8HKW 1.9 Å, Crystal structure of importin-alpha3 bound to the 53BP1 nuclear localization signal
7LFC 2.1 Å, Structure of importin a3 bound to p50 NLS
7RG5 2.15 Å, Importin alpha3 in complex with p50 NLS
6BWA 2.2 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 2
6BVV 2.3 Å, Nipah virus W protein C-terminus in complex with Importin alpha 3
6BVZ 2.3 Å, Importin alpha 3 in cargo free state
6BWB 2.3 Å, Hendra virus W protein C-terminus in complex with Importin alpha 3 crystal form 3
6WX8 2.3 Å, SOX2 bound to Importin-alpha 3
7JJL 2.6 Å, Crystal structure of Importin Alpha 3 in complex with human LSD1 NLS
4UAE 2.7 Å, Importin alpha 3 delta IBB in complex with Influenza PB2 Nuclear Localization Domain
8FUB 2.75 Å, Crystal structure of human Importin alpha 3 in complex with Hendra virus matrix protein…

Browse structure collections

About this viewer

MolViewer shows 7RFY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.