7LJ1: Human Prx1-Srx Decameric Complex

Human Prx1-Srx Decameric Complex. Determined by X-ray diffraction at 2.97 Å resolution. Released 14 Jul 2021.

Method: X-ray diffraction
Resolution: 2.97 Å
Organism: Homo sapiens
Chains: 40
Atoms: 44,942
Mol. weight: 684.84 kDa
Ligands: PO4, ATP
Released: 14 Jul 2021

Explore 7LJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LJ1 contains 324 α-helices and 333 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a, e, h, i, j and o: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	6
β-strand	49-50	2	6
α-helix	54-55	2
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	6
β-strand	91-95	5	6
α-helix	99-107	9
β-strand	112-120	9	6
α-helix	122-129	8
α-helix	130-132	3

Chains A and S: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
α-helix	12-14	3
β-strand	16-20	5	2
β-strand	26-30	5	2
α-helix	31-34	4
β-strand	38-43	6	2
α-helix	54-61	8
α-helix	63-68	6
β-strand	71-77	7	2
α-helix	81-88	8
α-helix	92-94	3
β-strand	104-106	3	2
α-helix	111-115	5
β-strand	119-120	2	3
β-strand	125-126	2	3
β-strand	128-133	6	2
β-strand	138	1	1
β-strand	139-145	7	2
α-helix	153-168	16
α-helix	173-175	3
α-helix	181-183	3
β-strand	184	1	4

Chains b, f and l: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	4
β-strand	49-50	2	4
α-helix	54-55	2
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	4
β-strand	91-94	4	4
α-helix	99-107	9
β-strand	112-120	9	4
α-helix	122-129	8
α-helix	130-132	3

Chains B, C, E, N, Q and T: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	8
α-helix	12-14	3
β-strand	16-20	5	2
β-strand	26-30	5	2
α-helix	31-34	4
β-strand	38-43	6	2
α-helix	54-61	8
α-helix	63-68	6
β-strand	71-77	7	2
α-helix	81-88	8
α-helix	92-94	3
β-strand	104-106	3	2
α-helix	111-115	5
β-strand	119-120	2	9
β-strand	125-126	2	9
β-strand	128-133	6	2
β-strand	138	1	8
β-strand	139-145	7	2
α-helix	153-168	16
α-helix	181-183	3
β-strand	184	1	6

Chains c and t: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	70
β-strand	49-50	2	70
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	70
β-strand	91-95	5	70
α-helix	99-107	9
β-strand	112-120	9	70
α-helix	122-129	8
α-helix	130-132	3

Chain d: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	41-45	5	14
α-helix	46-48	3
β-strand	49-50	2	14
α-helix	54-55	2
α-helix	59-71	13
α-helix	73-75	3
α-helix	77-78	2
β-strand	79-85	7	14
β-strand	91-94	4	14
α-helix	99-107	9
β-strand	112-120	9	14
α-helix	122-129	8
α-helix	130-132	3

Chain D: 9 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	16
α-helix	12-14	3
β-strand	16-20	5	12
β-strand	26-30	5	12
α-helix	31-34	4
β-strand	38-43	6	12
α-helix	54-61	8
α-helix	63-68	6
β-strand	71-77	7	12
α-helix	81-88	8
α-helix	92-94	3
β-strand	104-106	3	12
α-helix	111-115	5
β-strand	119-120	2	17
β-strand	125-126	2	17
β-strand	128-133	6	12
β-strand	138	1	16
β-strand	139-145	7	12
α-helix	153-168	16
α-helix	173-175	3

Chains F and O: 10 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	24
α-helix	12-14	3
β-strand	16-20	5	20
β-strand	26-30	5	20
α-helix	31-34	4
β-strand	38-43	6	20
α-helix	54-61	8
α-helix	63-68	6
β-strand	71-77	7	20
α-helix	81-88	8
α-helix	92-94	3
β-strand	104-106	3	20
α-helix	111-115	5
β-strand	119-120	2	25
β-strand	125-126	2	25
β-strand	128-133	6	20
β-strand	138	1	24
β-strand	139-145	7	20
α-helix	153-168	16
α-helix	181-183	3
β-strand	184-185	2	26
α-helix	186	1

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxiredoxin-1	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T	protein	199	Homo sapiens	Q06830 (AlphaFold model)
Sulfiredoxin-1	a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t	protein	109	Homo sapiens	Q9BYN0 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T), FASTA

>7LJ1_1 Peroxiredoxin-1 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T)
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNSQVIGASVDSHFVHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPG
SDTIKPDVQKSKEYFSKQK

Sequence of entity 2 (a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t), FASTA

>7LJ1_2 Sulfiredoxin-1 (chains a, b, c, d, e, f, g, h, i, j, k, l, m, n, o, p, q, r, s, t)
GPMSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQ
GGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	19
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Water and common crystallization additives (EDO, PEG, GOL) are not listed.

Primary citation

Specificity of Human Sulfiredoxin for Reductant and Peroxiredoxin Oligomeric State. Forshaw, T.E., Reisz, J.A., Nelson, K.J. et al. Antioxidants (Basel) (2021) 10. DOI 10.3390/antiox10060946 · PubMed

Other PDB entries of the same protein (UniProt Q06830 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Z54 1.45 Å, Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment
9VQ5 1.5 Å, Crystal structure of Peroxiredoxin I in complex with SAC
8X71 1.58 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-064
8X73 1.61 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-069
9LNH 1.63 Å, Crystal structure of Peroxiredoxin I in complex with compound LC-PDin20
9B7A 1.71 Å, Crystal structure of peroxiredoxin 1 with RA
7WET 1.76 Å, Crystal structure of Peroxiredoxin I in complex with the inhibitor Cela
9VGT 1.79 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-150
9VE2 1.8 Å, Crystal Structure of Human Peroxiredoxin I in Complex with Fluvastatin
8Z56 1.81 Å, Crystal structure of human Q140L-SIRT5 in complex with succinylated Prx1 fragment
7WEU 1.81 Å, Crystal structure of Peroxiredoxin I in complex with compound 19-048
9LG0 1.81 Å, Crystal Structure of Human Peroxiredoxin I in Complex with SAB

Browse structure collections

About this viewer

MolViewer shows 7LJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.