7LUO: N-terminus of Skp2

N-terminus of Skp2 bound to Cyclin A. Determined by X-ray diffraction at 3.17 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 3.17 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,106
Mol. weight: 77.18 kDa
Released: 12 May 2021

Explore 7LUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7LUO contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	4174-4176	3
α-helix	4182-4191	10
α-helix	4199-4202	4
α-helix	4208-4224	17
α-helix	4229-4245	17
α-helix	4250-4268	19
α-helix	4275-4281	7
α-helix	4288-4301	14
α-helix	4311-4319	9
α-helix	4327-4342	16
α-helix	4352-4367	16
α-helix	4374-4380	7
α-helix	4388-4399	12
α-helix	4408-4412	5
α-helix	4416-4418	3
α-helix	4421-4423	3
α-helix	4425-4427	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-phase kinase-associated protein 2,Cyclin-A2	A, C	protein	335	Homo sapiens	P20248 (AlphaFold model), Q13309 (AlphaFold model)
Skp2 Motif 1 uncharacterized fragment 1	B	protein	8	Homo sapiens
Skp2 Motif 1 uncharacterized fragment 2	D	protein	7	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>7LUO_1 S-phase kinase-associated protein 2,Cyclin-A2 (chains A, C)
GAMGATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKS
KGSDKDFVIVRRGSGNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDW
LVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAE
FVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLG
ELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQT
YLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

Sequence of entity 2 (B), FASTA

>7LUO_2 Skp2 Motif 1 uncharacterized fragment 1 (chains B)
XXXXXXXX

Sequence of entity 3 (D), FASTA

>7LUO_3 Skp2 Motif 1 uncharacterized fragment 2 (chains D)
XXXXXXX

Primary citation

Bipartite binding of the N terminus of Skp2 to cyclin A. Kelso, S., Orlicky, S., Beenstock, J. et al. Structure (2021) 29:975. DOI 10.1016/j.str.2021.04.011 · PubMed

Other PDB entries of the same protein (UniProt P20248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

11GV 1.59 Å, Crystal structure of selective inhibitor 16 bound at the active site of CDK2
9D97 1.6 Å, KIR3DL - HLA complex
4EOJ 1.65 Å, Thr 160 phosphorylated CDK2 H84S, Q85M, K89D - human cyclin A3 complex with ATP
2CCH 1.7 Å, The crystal structure of CDK2 cyclin A in complex with a substrate peptide derived from…
7QHL 1.7 Å, Crystal structure of Cyclin-dependent kinase 2/cyclin A in complex with…
7ACK 1.8 Å, CDK2/cyclin A2 in complex with an imidazo[1,2-c]pyrimidin-5-one inhibitor
6ATH 1.82 Å, Cdk2/cyclin A/p27-KID-deltaC
4EOP 1.99 Å, Thr 160 phosphorylated CDK2 Q131E - human cyclin A3 complex with the inhibitor RO3306
1H1R 2.0 Å, Structure of human Thr160-phospho CDK2/cyclin A complexed with the inhibitor NU6086
1H1S 2.0 Å, Structure of human Thr160-phospho CDK2/cyclin A complexed with the inhibitor NU6102
1OIU 2.0 Å, Structure of human Thr160-phospho CDK2/cyclin A complexed with a…
2IW9 2.0 Å, Structure of human THR160-phospho CDK2-cyclin a complexed with a bisanilinopyrimidine…

Browse structure collections

About this viewer

MolViewer shows 7LUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.