T4 lysozyme mutant L99A. Determined by X-ray diffraction at 1.07 Å resolution. Released 25 Aug 2021.
Explore 7LXA in 3D Show helices and sheets RCSB PDB PDBe
7LXA contains 9 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 | |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 16 | 1 | 2 |
| β-strand | 17-19 | 3 | 1 |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 31-34 | 4 | 1 |
| α-helix | 39-50 | 12 | |
| β-strand | 57 | 1 | 2 |
| α-helix | 60-79 | 20 | |
| α-helix | 84-90 | 7 | |
| α-helix | 93-106 | 14 | |
| α-helix | 115-122 | 8 | |
| α-helix | 126-134 | 9 | |
| α-helix | 137-141 | 5 | |
| α-helix | 143-155 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysozyme | A | protein | 172 | Enterobacteria phage T4 | D9IEF7 |
>7LXA_1 Lysozyme (chains A) MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITK DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCAAINMVFQMGETGVAGFTNSLRM LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNLLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| YGS | (2-methylprop-2-en-1-yl)benzene | C10 H12 | 1 |
Water and common crystallization additives (TRS, BME) are not listed.
Energy penalties enhance flexible receptor docking in a model cavity. Kamenik, A.S., Singh, I., Lak, P. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2106195118 · PubMed
Other PDB entries of the same protein (UniProt D9IEF7), best resolution first:
MolViewer shows 7LXA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.