T4 lysozyme mutant-S44C/C54T/N68C/A93C/C97A/T115C, DMSO 40%, and then backsoaking. Determined by X-ray diffraction at 1.1 Å resolution. Released 22 Mar 2023.
Explore 7XEA in 3D Show helices and sheets RCSB PDB PDBe
7XEA contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 | |
| β-strand | 14-15 | 2 | 1 |
| β-strand | 16 | 1 | 2 |
| β-strand | 17-19 | 3 | 1 |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 31-32 | 2 | 1 |
| α-helix | 39-50 | 12 | |
| β-strand | 57 | 1 | 2 |
| α-helix | 60-80 | 21 | |
| α-helix | 84-90 | 7 | |
| α-helix | 93-106 | 14 | |
| α-helix | 108-112 | 5 | |
| α-helix | 115-122 | 8 | |
| α-helix | 126-133 | 8 | |
| α-helix | 137-141 | 5 | |
| α-helix | 143-155 | 13 | |
| α-helix | 159-161 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endolysin | A | protein | 164 | Escherichia virus T4 | D9IEF7 |
>7XEA_1 Endolysin (chains A) MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKCELDKAIGRNTNGVITK DEAEKLFCQDVDAAVRGILRNAKLKPVYDSLDCVRRAALINMVFQMGETGVAGFCNSLRM LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL
Creation of Cross-Linked Crystals With Intermolecular Disulfide Bonds Connecting Symmetry-Related Molecules Allows Retention of Tertiary Structure in Different Solvent Conditions. Hiromoto, T., Ikura, T., Honjo, E. et al. Front Mol Biosci (2022) 9:908394-908394. DOI 10.3389/fmolb.2022.908394 · PubMed
Other PDB entries of the same protein (UniProt D9IEF7), best resolution first:
MolViewer shows 7XEA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.