Incomplete in crystallo incorporation by DNA Polymerase Lambda bound to blunt-ended DSB substrate and incoming dTTP. Determined by X-ray diffraction at 1.83 Å resolution. Released 16 Mar 2022.
Explore 7M0A in 3D Show helices and sheets RCSB PDB PDBe
7M0A contains 25 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 240-242 | 3 | |
| α-helix | 245-250 | 6 | |
| α-helix | 254-269 | 16 | |
| α-helix | 273-288 | 16 | |
| α-helix | 296-301 | 6 | |
| α-helix | 307-319 | 13 | |
| α-helix | 323-326 | 4 | |
| α-helix | 332-339 | 8 | |
| α-helix | 346-354 | 9 | |
| α-helix | 360-366 | 7 | |
| α-helix | 371-378 | 8 | |
| α-helix | 380-384 | 5 | |
| α-helix | 385-386 | 2 | |
| β-strand | 387-388 | 2 | 1 |
| α-helix | 389-404 | 16 | |
| β-strand | 411-414 | 4 | 2 |
| α-helix | 416-419 | 4 | |
| β-strand | 424-425 | 2 | 1 |
| β-strand | 427-433 | 7 | 2 |
| α-helix | 443-453 | 11 | |
| β-strand | 457-462 | 6 | 2 |
| β-strand | 472-477 | 6 | 2 |
| β-strand | 487-493 | 7 | 2 |
| α-helix | 496-498 | 3 | |
| α-helix | 499-507 | 9 | |
| α-helix | 510-522 | 13 | |
| β-strand | 525-527 | 3 | 3 |
| β-strand | 532-534 | 3 | 3 |
| α-helix | 535-536 | 2 | |
| α-helix | 549 | 1 | |
| β-strand | 550 | 1 | 3 |
| α-helix | 551-552 | 2 | |
| α-helix | 556-562 | 7 | |
| α-helix | 565-567 | 3 | |
| α-helix | 570-573 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA polymerase lambda | A | protein | 346 | Homo sapiens | Q9UGP5 (AlphaFold model) |
| DNA (5'-d(*cp*gp*gp*cp*a)-3') | T | DNA | 5 | synthetic construct | |
| DNA (5'-d(*cp*ap*gp*tp*gp*cp*t)-3') | P | DNA | 7 | synthetic construct | |
| DNA (5'-d(p*gp*cp*cp*g)-3') | D | DNA | 4 | synthetic construct | |
| DNA (5'-d(*gp*cp*ap*cp*tp*g)-3') | U | DNA | 6 | synthetic construct |
>7M0A_1 DNA polymerase lambda (chains A) GSAAAVLDKWVCAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSF HKPVTSYQEACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTA QMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSG LLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQ QQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSE HALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
>7M0A_2 DNA (5'-D(*CP*GP*GP*CP*A)-3') (chains T) CGGCA
>7M0A_3 DNA (5'-D(*CP*AP*GP*TP*GP*CP*T)-3') (chains P) CAGTGCT
>7M0A_4 DNA (5'-D(P*GP*CP*CP*G)-3') (chains D) GCCG
>7M0A_5 DNA (5'-D(*GP*CP*AP*CP*TP*G)-3') (chains U) GCACTG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| MG | Magnesium ion | Mg | 2 |
| PPV | Pyrophosphate | H4 O7 P2 | 1 |
| TTP | Thymidine-5'-triphosphate | C10 H17 N2 O14 P3 | 1 |
Water and common crystallization additives (GOL, CL, NA) are not listed.
Analysis of diverse double-strand break synapsis with Pol lambda reveals basis for unique substrate specificity in nonhomologous end-joining. Kaminski, A.M., Chiruvella, K.K., Ramsden, D.A. et al. Nat Commun (2022) 13:3806-3806. DOI 10.1038/s41467-022-31278-4 · PubMed
Other PDB entries of the same protein (UniProt Q9UGP5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7M0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.