7M5U: Human MPP8 chromodomain

Crystal structure of human MPP8 chromodomain in complex with peptidomimetic ligand UNC5246. Determined by X-ray diffraction at 2.02 Å resolution. Released 1 Sept 2021.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 2
Atoms: 550
Mol. weight: 8.14 kDa
Released: 1 Sept 2021

Explore 7M5U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M5U contains 3 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	58-59	2	1
β-strand	61-70	10	2
β-strand	73-80	8	2
α-helix	85-87	3
β-strand	89-92	4	2
α-helix	93-96	4
α-helix	100-112	13

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-4	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M-phase phosphoprotein 8	A	protein	62	Homo sapiens	Q99549 (AlphaFold model)
UNC5246	B	protein	7	Homo sapiens

Sequence of entity 1 (A), FASTA

>7M5U_1 M-phase phosphoprotein 8 (chains A)
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
AK

Sequence of entity 2 (B), FASTA

>7M5U_2 UNC5246 (chains B)
XFAFXSX

Primary citation

A Peptidomimetic Ligand Targeting the Chromodomain of MPP8 Reveals HRP2's Association with the HUSH Complex. Waybright, J.M., Clinkscales, S.E., Barnash, K.D. et al. ACS Chem Biol (2021) 16:1721-1736. DOI 10.1021/acschembio.1c00429 · PubMed

Other PDB entries of the same protein (UniProt Q99549 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V2S 1.6 Å, Crystal Structure of chromodomain of MPP8 in complex with inhibitor UNC3866
9H77 2.01 Å, MPP8 chromodomain in complex with nanobody 3A02
3LWE 2.05 Å, The crystal structure of MPP8
3R93 2.06 Å, Crystal structure of the chromo domain of M-phase phosphoprotein 8 bound to H3K9Me3…
3SVM 2.31 Å, Human MPP8 - human DNMT3AK47me2 peptide
3QO2 2.49 Å, Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9
8QFB 3.04 Å, Crystal structure of human MPP8 C-terminal region (residues 565-860)

Browse structure collections

About this viewer

MolViewer shows 7M5U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.