7M6T: SOCS2/ElonginB/ElonginC

Crystal structure of SOCS2/ElonginB/ElonginC bound to a non-canonical peptide that enhances phospho-peptide binding. Determined by X-ray diffraction at 3.19 Å resolution. Released 13 Oct 2021.

Method: X-ray diffraction
Resolution: 3.19 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 2,670
Mol. weight: 45.01 kDa
Released: 13 Oct 2021

Explore 7M6T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M6T contains 21 α-helices and 21 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	32-46	15
β-strand	49	1	1
α-helix	55-62	8
α-helix	66	1
β-strand	70-74	5	1
β-strand	82-88	7	1
β-strand	91-100	10	1
β-strand	103-106	4	1
β-strand	119	1	1
α-helix	122-132	11
β-strand	155	1	1
α-helix	160-162	3
α-helix	163-174	12
α-helix	178-180	3
α-helix	185-193	9

Chain B: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	2
β-strand	10	1	3
β-strand	12-18	7	2
β-strand	23	1	4
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	2
β-strand	49-50	2	2
α-helix	51-52	2
β-strand	56	1	4
α-helix	57-60	4
β-strand	68	1	5
β-strand	71	1	5
α-helix	72	1
β-strand	73-79	7	2
β-strand	90	1	3
α-helix	91-100	10
α-helix	101-103	3

Chain C: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	2
β-strand	28-32	5	2
α-helix	33-36	4
α-helix	40-44	5
β-strand	59-61	3	2
α-helix	67-82	16
α-helix	90-92	3
α-helix	97-110	14

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-13	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Suppressor of cytokine signaling 2	A	protein	170	Homo sapiens	O14508 (AlphaFold model)
Elongin-B	B	protein	118	Homo sapiens	Q15370 (AlphaFold model)
Elongin-C	C	protein	96	Homo sapiens	Q15369 (AlphaFold model)
Non-canonical peptide F3	D	protein	12	synthetic construct

Sequence of entity 1 (A), FASTA

>7M6T_1 Suppressor of cytokine signaling 2 (chains A)
ARQQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKT
SAGPTNLRIEYQDGKFRLDSIICVKSALAAFDSVVHLIDYYVQMCKDKRTGPEAPRNGTV
HLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Sequence of entity 2 (B), FASTA

>7M6T_2 Elongin-B (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ

Sequence of entity 3 (C), FASTA

>7M6T_3 Elongin-C (chains C)
MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMY
FTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Sequence of entity 4 (D), FASTA

>7M6T_4 Non-canonical peptide F3 (chains D)
ALQHLMDKWMAM

Primary citation

Discovery of an exosite on the SOCS2-SH2 domain that enhances SH2 binding to phosphorylated ligands. Linossi, E.M., Li, K., Veggiani, G. et al. Nat Commun (2021) 12:7032-7032. DOI 10.1038/s41467-021-26983-5 · PubMed

Other PDB entries of the same protein (UniProt O14508 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZLM 1.79 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound MN551
2C9W 1.9 Å, Crystal structure of socs-2 in complex with elongin-B and elongin-C at 1.9A resolution
7ZLS 1.92 Å, co-crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 13
7ZLP 1.94 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 9
6I5N 1.98 Å, Crystal structure of SOCS2:Elongin C:Elongin B in complex with growth hormone receptor…
7ZLR 2.01 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 13
7ZLO 2.22 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 12
7ZLN 2.6 Å, Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 11
6I4X 2.69 Å, Crystal structure of SOCS2:Elongin C:Elongin B in complex with erythropoietin receptor…
6I5J 2.8 Å, Crystal structure of SOCS2:Elongin C:Elongin B in complex with growth hormone receptor…
5BO4 2.9 Å, Structure of SOCS2:Elongin C:Elongin B from DMSO-treated crystals
4JGH 3.0 Å, Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5

Browse structure collections

About this viewer

MolViewer shows 7M6T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.