7MEI: Composite structure of EC+EC

Name: PDB 7MEI: Composite structure of EC+EC
Published: 2022-03-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Composite structure of EC+EC. Determined by electron microscopy at 3.54 Å resolution. Released 2 Mar 2022.

Method: Electron microscopy
Resolution: 3.54 Å
Organism: Saccharomyces cerevisiae
Chains: 30
Atoms: 69,281
Mol. weight: 1213.88 kDa
Ligands: MG, ZN
Released: 2 Mar 2022

Explore 7MEI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MEI contains 343 α-helices and 458 β-strands across 26 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 68 helices, 74 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
β-strand	17-18	2	2
α-helix	24-30	7
β-strand	34	1	3
β-strand	82-83	2	3
β-strand	90	1	4
α-helix	93-95	3
α-helix	97-105	9
β-strand	106-107	2	5
β-strand	112-113	2	5
α-helix	121-127	7
α-helix	133-141	9
β-strand	147	1	6
β-strand	170	1	6
α-helix	171-172	2
β-strand	173-177	5	7
β-strand	180-185	6	7
β-strand	192	1	8
β-strand	196	1	8
α-helix	197	1
β-strand	198-201	4	7
α-helix	202-203	2
α-helix	204-213	10
α-helix	216-221	6
α-helix	231-234	4
β-strand	236	1	4
β-strand	240-241	2	3
α-helix	244-246	3
β-strand	249	1	9
β-strand	259	1	9
α-helix	261-281	21
α-helix	289-304	16
β-strand	315	1	10
β-strand	321	1	10
α-helix	322	1
α-helix	325-329	5
β-strand	343-344	2	11
β-strand	348-352	5	12
β-strand	353-354	2	13
β-strand	365-367	3	13
α-helix	368-373	6
β-strand	376-379	4	14
α-helix	385-394	10
β-strand	402-406	5	14
β-strand	412-414	3	14
β-strand	431-434	4	14
β-strand	442-445	4	12
β-strand	455-458	4	12
β-strand	461-463	3	13
β-strand	468-469	2	13
α-helix	472-474	3
α-helix	475-478	4
β-strand	486-490	5	12
α-helix	495-501	7
β-strand	506	1	12
α-helix	507-510	4
β-strand	512-513	2	15
β-strand	518-519	2	15
α-helix	525-534	10
α-helix	543-552	10
α-helix	560-563	4
β-strand	565	1	16
β-strand	571	1	16
α-helix	574-580	7
α-helix	583	1
β-strand	587-589	3	17
β-strand	606-608	3	17
β-strand	611-612	2	17
α-helix	619-622	4
α-helix	629-636	8
α-helix	641-660	20
β-strand	663	1	18
α-helix	666-668	3
α-helix	673-698	26
α-helix	710-736	27
α-helix	742-748	7
α-helix	755-762	8
β-strand	767	1	19
β-strand	799	1	19
α-helix	810-842	33
β-strand	849-850	2	20
β-strand	856-857	2	20
β-strand	863-865	3	20
α-helix	868-870	3
β-strand	873	1	21
β-strand	879	1	22
α-helix	881	1
β-strand	882	1	23
α-helix	883	1
α-helix	890-897	8
α-helix	907-909	3
α-helix	910-912	3
β-strand	913	1	24
α-helix	923-946	24
β-strand	953	1	23
β-strand	956	1	22
α-helix	961-969	9
β-strand	979	1	24
α-helix	983-996	14
α-helix	1005-1014	10
α-helix	1016-1025	10
α-helix	1028-1030	3
α-helix	1031-1035	5
α-helix	1039-1055	17
β-strand	1057	1	21
α-helix	1058-1059	2
α-helix	1064-1077	14
α-helix	1097-1105	9
β-strand	1116-1119	4	25
β-strand	1120	1	26
α-helix	1128-1138	11
β-strand	1142	1	27
α-helix	1143-1146	4
β-strand	1147-1154	8	28
α-helix	1168-1172	5
β-strand	1188	1	29
β-strand	1191-1197	7	28
α-helix	1199-1204	6
α-helix	1209-1219	11
β-strand	1224-1228	5	28
β-strand	1236-1242	7	28
β-strand	1243	1	29
α-helix	1256-1268	13
β-strand	1272	1	27
β-strand	1283-1292	10	25
β-strand	1298-1307	10	25
α-helix	1316-1318	3
β-strand	1322	1	26
β-strand	1328-1329	2	25
α-helix	1332-1338	7
α-helix	1341-1357	17
α-helix	1365-1376	12
β-strand	1377	1	30
β-strand	1380	1	30
α-helix	1396-1400	5
α-helix	1407-1415	9
β-strand	1418-1419	2	2
α-helix	1424-1430	7
β-strand	1437	1	31
α-helix	1438-1440	3
β-strand	1443-1445	3	32
α-helix	1448-1452	5

Chain A: 67 helices, 65 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	77
β-strand	17-18	2	78
α-helix	24-30	7
β-strand	34	1	79
β-strand	83-90	8	79
α-helix	93-95	3
α-helix	96-105	10
β-strand	106-107	2	80
β-strand	112-113	2	80
α-helix	120-127	8
α-helix	133-141	9
β-strand	147	1	81
β-strand	170	1	81
α-helix	171-172	2
β-strand	173-177	5	82
β-strand	180-185	6	82
β-strand	198-201	4	82
α-helix	204-212	9
α-helix	216-221	6
α-helix	231-234	4
β-strand	236-240	5	79
α-helix	244-246	3
α-helix	261-281	21
α-helix	288-304	17
β-strand	315	1	83
β-strand	321	1	83
α-helix	322-323	2
α-helix	325-329	5
β-strand	343-345	3	84
β-strand	348-352	5	85
β-strand	353-355	3	86
β-strand	363-367	5	86
α-helix	368-373	6
β-strand	376-379	4	87
α-helix	385-394	10
β-strand	402-406	5	87
β-strand	412-414	3	87
β-strand	431-434	4	87
β-strand	442-445	4	85
α-helix	449	1
β-strand	455-458	4	85
β-strand	459-463	5	86
β-strand	468-470	3	86
α-helix	475-478	4
β-strand	486-490	5	85
α-helix	495-504	10
β-strand	506	1	85
α-helix	507-510	4
β-strand	512-513	2	88
β-strand	518-519	2	88
α-helix	525-534	10
α-helix	543-552	10
α-helix	560-563	4
β-strand	565	1	89
β-strand	571	1	89
α-helix	574-581	8
α-helix	583	1
β-strand	588-589	2	90
β-strand	605-608	4	90
β-strand	611-615	5	90
α-helix	619-622	4
α-helix	629-636	8
α-helix	641-660	20
β-strand	663	1	91
α-helix	666-669	4
α-helix	673-698	26
α-helix	710-736	27
α-helix	742-748	7
α-helix	755-762	8
α-helix	774-775	2
β-strand	779	1	92
β-strand	782	1	92
α-helix	810-844	35
β-strand	849-850	2	93
β-strand	856-857	2	93
β-strand	863-865	3	93
α-helix	868-870	3
β-strand	873	1	94
β-strand	879-882	4	95
α-helix	883	1
α-helix	890-897	8
α-helix	907-909	3
β-strand	913	1	96
α-helix	914-916	3
α-helix	924-946	23
β-strand	953-956	4	95
α-helix	961-971	11
β-strand	979	1	96
α-helix	983-996	14
α-helix	1005-1014	10
α-helix	1016-1025	10
α-helix	1028-1030	3
α-helix	1031-1035	5
α-helix	1039-1055	17
β-strand	1057	1	94
α-helix	1058-1059	2
α-helix	1064-1073	10
α-helix	1074-1076	3
α-helix	1097-1105	9
β-strand	1116-1119	4	97
β-strand	1120	1	98
α-helix	1128-1138	11
β-strand	1139	1	99
β-strand	1142	1	100
α-helix	1143-1146	4
β-strand	1147-1154	8	101
α-helix	1164-1166	3
α-helix	1168-1173	6
β-strand	1188	1	102
β-strand	1191-1197	7	101
α-helix	1199-1204	6
α-helix	1209-1220	12
β-strand	1224-1228	5	101
β-strand	1236-1242	7	101
β-strand	1243	1	102
α-helix	1256-1270	15
β-strand	1272	1	100
β-strand	1276	1	99
β-strand	1283-1292	10	97
β-strand	1298-1307	10	97
β-strand	1322	1	98
β-strand	1328-1329	2	97
α-helix	1332-1338	7
α-helix	1341-1357	17
α-helix	1365-1376	12
α-helix	1396-1400	5
α-helix	1405-1415	11
β-strand	1418-1419	2	78
α-helix	1424-1430	7
α-helix	1437-1439	3
β-strand	1441-1445	5	103
α-helix	1447-1452	6

Chain b: 49 helices, 80 β-strands

Element	Residues	Length	Sheet
α-helix	28-30	3
α-helix	31-41	11
α-helix	45-56	12
α-helix	59-65	7
β-strand	69-73	5	34
β-strand	84	1	35
β-strand	86-90	5	34
β-strand	92-97	6	36
β-strand	101-103	3	37
α-helix	108	1
β-strand	109-111	3	37
α-helix	114-120	7
β-strand	125-132	8	36
β-strand	140	1	35
β-strand	165-171	7	36
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-204	2	38
β-strand	209-210	2	38
β-strand	214-218	5	39
β-strand	224-227	4	40
β-strand	234-240	7	40
α-helix	247-249	3
β-strand	254-259	6	40
β-strand	268-273	6	40
β-strand	276-281	6	40
α-helix	282-289	8
α-helix	294-301	8
α-helix	309-320	12
α-helix	321-323	3
α-helix	327-332	6
α-helix	349-358	10
α-helix	371-389	19
β-strand	404-407	4	39
α-helix	409-429	21
α-helix	445-463	19
α-helix	481	1
β-strand	482	1	38
α-helix	483-484	2
α-helix	488-495	8
β-strand	498-499	2	39
α-helix	516-518	3
β-strand	522	1	41
β-strand	537	1	39
β-strand	539	1	41
β-strand	544-545	2	42
α-helix	552-560	9
β-strand	564	1	43
α-helix	566-568	3
β-strand	578-582	5	43
β-strand	585-590	6	43
α-helix	593-606	14
β-strand	614-618	5	43
β-strand	623-627	5	43
β-strand	633-639	7	42
β-strand	640-641	2	44
β-strand	650-651	2	44
α-helix	655-667	13
α-helix	681-687	7
β-strand	690-694	5	42
α-helix	695-698	4
β-strand	703-704	2	42
β-strand	740-741	2	42
α-helix	745-748	4
α-helix	751-755	5
α-helix	759-761	3
β-strand	762	1	45
α-helix	764-774	11
β-strand	777	1	46
β-strand	792-796	5	47
α-helix	809-812	4
β-strand	821-827	7	48
β-strand	828	1	18
β-strand	839-842	4	48
α-helix	843-848	6
β-strand	853-862	10	47
β-strand	873	1	49
α-helix	890-892	3
β-strand	898	1	50
α-helix	899-900	2
β-strand	904-905	2	47
β-strand	910-912	3	50
β-strand	915	1	49
β-strand	936	1	49
β-strand	939-940	2	50
α-helix	941-942	2
β-strand	947-955	9	47
β-strand	963-969	7	47
β-strand	972	1	47
β-strand	978	1	51
β-strand	979	1	52
β-strand	980-981	2	51
β-strand	989	1	52
β-strand	990-994	5	48
α-helix	996-998	3
β-strand	1001	1	53
β-strand	1010-1012	3	48
α-helix	1014-1016	3
β-strand	1022	1	45
α-helix	1024-1038	15
α-helix	1052-1062	11
β-strand	1069-1070	2	54
β-strand	1073	1	53
α-helix	1079	1
β-strand	1080	1	53
α-helix	1081	1
β-strand	1085-1086	2	54
β-strand	1087-1092	6	48
β-strand	1093-1098	6	51
α-helix	1099-1102	4
β-strand	1104-1106	3	12
β-strand	1111	1	55
β-strand	1118	1	55
α-helix	1119	1
α-helix	1128	1
β-strand	1129-1130	2	11
α-helix	1132-1141	10
β-strand	1143	1	31
α-helix	1144-1152	9
β-strand	1158-1162	5	1
β-strand	1163	1	56
β-strand	1168	1	56
β-strand	1174	1	57
β-strand	1179	1	57
β-strand	1182	1	58
β-strand	1187	1	58
β-strand	1192-1196	5	1
α-helix	1198-1209	12
β-strand	1215-1216	2	2

Chain B: 50 helices, 77 β-strands

Element	Residues	Length	Sheet
α-helix	27-29	3
α-helix	30-41	12
α-helix	45-56	12
α-helix	60-65	6
β-strand	68-70	3	104
β-strand	73	1	105
β-strand	86	1	105
β-strand	89-91	3	104
β-strand	92-97	6	106
β-strand	101-103	3	107
α-helix	108	1
β-strand	109-111	3	107
α-helix	114-120	7
β-strand	125-132	8	106
β-strand	165-171	7	106
α-helix	180-183	4
α-helix	186-191	6
β-strand	203-204	2	108
β-strand	209-210	2	108
β-strand	214-218	5	109
β-strand	224-226	3	110
β-strand	234-240	7	110
β-strand	254-259	6	110
β-strand	268-272	5	110
β-strand	280-281	2	110
α-helix	282-289	8
α-helix	294-301	8
α-helix	309-320	12
α-helix	327-331	5
α-helix	349-354	6
α-helix	355-359	5
α-helix	371-389	19
β-strand	404-407	4	109
α-helix	409-429	21
α-helix	445-463	19
α-helix	481	1
β-strand	482	1	108
α-helix	483-484	2
α-helix	488-495	8
β-strand	497	1	111
β-strand	498-499	2	109
α-helix	516-518	3
β-strand	522	1	112
β-strand	538	1	111
β-strand	539	1	112
β-strand	544-547	4	113
α-helix	552-560	9
β-strand	564-565	2	114
α-helix	566-568	3
β-strand	578-582	5	114
β-strand	585-590	6	114
α-helix	593-605	13
β-strand	614-618	5	114
β-strand	623-627	5	114
β-strand	630-635	6	113
β-strand	638-639	2	115
β-strand	640-641	2	116
β-strand	650-651	2	116
α-helix	655-666	12
α-helix	681-686	6
β-strand	690	1	115
β-strand	693-694	2	113
α-helix	697-700	4
β-strand	703-704	2	115
β-strand	740-741	2	115
α-helix	745-748	4
α-helix	751-754	4
α-helix	759-761	3
β-strand	762	1	117
α-helix	764-774	11
α-helix	784-786	3
β-strand	792-796	5	118
β-strand	800	1	119
α-helix	808-811	4
β-strand	822-827	6	120
β-strand	828	1	91
β-strand	838-842	5	120
α-helix	843-848	6
β-strand	853-862	10	118
β-strand	865	1	121
β-strand	871	1	121
α-helix	890-892	3
β-strand	893	1	122
β-strand	899	1	122
α-helix	900	1
β-strand	904	1	118
β-strand	910	1	123
α-helix	938-939	2
β-strand	940	1	123
α-helix	941-942	2
β-strand	948-955	8	118
β-strand	963-969	7	118
β-strand	972	1	118
β-strand	979-981	3	120
β-strand	988-994	7	120
α-helix	996-998	3
β-strand	1001	1	124
β-strand	1010-1012	3	120
α-helix	1016-1020	5
β-strand	1022	1	117
α-helix	1024-1038	15
α-helix	1052-1061	10
β-strand	1069-1070	2	125
β-strand	1073	1	124
α-helix	1079	1
β-strand	1080	1	124
α-helix	1081	1
β-strand	1085-1086	2	125
β-strand	1087-1091	5	120
β-strand	1093-1094	2	120
α-helix	1099-1102	4
β-strand	1104-1106	3	85
β-strand	1111	1	126
β-strand	1118	1	126
α-helix	1119-1120	2
β-strand	1128-1130	3	84
α-helix	1132-1141	10
α-helix	1144-1152	9
β-strand	1158-1162	5	77
β-strand	1163	1	127
β-strand	1168	1	127
β-strand	1174	1	128
α-helix	1175-1177	3
β-strand	1179	1	128
β-strand	1192-1196	5	77
α-helix	1198-1209	12
β-strand	1215-1216	2	78

Chain c: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	59
β-strand	17-22	6	59
α-helix	27-39	13
β-strand	42	1	60
β-strand	45-51	7	61
α-helix	60-67	8
β-strand	72-74	3	62
α-helix	77-79	3
α-helix	93-95	3
β-strand	97-104	8	61
β-strand	111-112	2	63
α-helix	115-117	3
β-strand	119-120	2	61
β-strand	129-132	4	62
α-helix	133	1
β-strand	146-147	2	63
β-strand	152-160	9	61
β-strand	163	1	60
α-helix	168-170	3
β-strand	176-179	4	59
α-helix	205-208	4
α-helix	218-219	2
β-strand	228-233	6	59
α-helix	240-265	26

Chain C: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	129
β-strand	17-22	6	129
α-helix	27-39	13
β-strand	42	1	130
β-strand	45-54	10	131
α-helix	60-67	8
β-strand	72-74	3	132
α-helix	93-95	3
β-strand	97-104	8	131
β-strand	111-114	4	133
α-helix	115-117	3
β-strand	119-120	2	131
β-strand	129-132	4	132
α-helix	133	1
β-strand	143-147	5	133
β-strand	152-160	9	131
β-strand	163	1	130
α-helix	168-170	3
β-strand	176-179	4	129
α-helix	211-212	2
β-strand	228-233	6	129
α-helix	240-265	26

Chain d: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	36-37	2	64
β-strand	45-46	2	64
β-strand	49	1	32
α-helix	52-74	23
α-helix	119-133	15
α-helix	139-151	13
α-helix	157-170	14
α-helix	174-178	5
α-helix	179-182	4
α-helix	188-194	7
α-helix	196-201	6
α-helix	204-215	12

Chain D: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	36-38	3	134
β-strand	44-46	3	134
β-strand	48-49	2	103
α-helix	52-75	24
α-helix	119-133	15
α-helix	139-151	13
α-helix	157-170	14
α-helix	174-182	9
α-helix	188-194	7
α-helix	196-201	6
α-helix	204-215	12
α-helix	219-220	2

18 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (74-mer)	N	DNA	74	Saccharomyces cerevisiae
DNA (74-mer)	O	DNA	74	Saccharomyces cerevisiae
DNA-directed RNA polymerase subunit	A, a	protein	1733	Saccharomyces cerevisiae	P04050 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	B, b	protein	1224	Saccharomyces cerevisiae	P08518 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB3	C, c	protein	318	Saccharomyces cerevisiae	P16370 (AlphaFold model)
DNA-directed RNA polymerase II subunit RPB4	D, d	protein	221	Saccharomyces cerevisiae	P20433 (AlphaFold model)
DNA-directed RNA polymerases I, II, and III subunit RPABC1	E, e	protein	215	Saccharomyces cerevisiae	P20434
DNA-directed RNA polymerases I, II, and III subunit RPABC2	F, f	protein	155	Saccharomyces cerevisiae	P20435
DNA-directed RNA polymerase II subunit RPB7	G, g	protein	171	Saccharomyces cerevisiae	P34087
DNA-directed RNA polymerases I, II, and III subunit RPABC3	H, h	protein	146	Saccharomyces cerevisiae	P20436
DNA-directed RNA polymerase II subunit RPB9	I, i	protein	122	Saccharomyces cerevisiae	P27999
DNA-directed RNA polymerases II subunit RPABC5	J, j	protein	70	Saccharomyces cerevisiae	P22139

6 more molecules are not listed.

Sequence of entity 1 (N), FASTA

>7MEI_1 DNA (74-MER) (chains N)
CACTAGTGCCTAAAAAAAATTTATAGTGCAAAAAAACCAAAAAAAAAAATTCTCCTTCGA
GTGCTTATCGGTAA

Sequence of entity 2 (O), FASTA

>7MEI_2 DNA (74-MER) (chains O)
CTACCGATAAGCACTCGGATAGTAGAGTTTTTTTTTGGTTTTTTTGCACTATATTTGTGG
GGAAGGCACTAGTG

Sequence of entity 3 (A, a), FASTA

>7MEI_3 DNA-directed RNA polymerase subunit (chains A, a)
MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGS
IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNE
LMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLK
LVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHV
ATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLE
LDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKR
AGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTF
IELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSP
KDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHN
GFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFV
DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR
LVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVD
LLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCC
LLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMT
LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEH
TTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHML
KKIENTMLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVP
GIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGG
LTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGS
NDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTS
PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYS
PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR

Sequence of entity 4 (B, b), FASTA

>7MEI_4 DNA-directed RNA polymerase subunit beta (chains B, b)
MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQ
DIICEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLR
NLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCY
LSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEH
ICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEF
LPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKTL
FKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LMSCISVGTDPMPIITFLSEWGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETL
RTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIVEDDESLGHKELKVRKGHIAK
LMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGV
FLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMI
MNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIA
PGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSR
MTVAHLIECLLSKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKK
LMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIA
HGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF

Sequence of entity 5 (C, c), FASTA

>7MEI_5 DNA-directed RNA polymerase II subunit RPB3 (chains C, c)
MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD
EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI
VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY
DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY
SNASQMGNTGSGGYDNAW

Sequence of entity 6 (D, d), FASTA

>7MEI_6 DNA-directed RNA polymerase II subunit RPB4 (chains D, d)
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY

Sequence of entity 7 (E, e), FASTA

>7MEI_7 DNA-directed RNA polymerases I, II, and III subunit RPABC1 (chains E, e)
MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSF
QANPTEESISKFPDMGSLWVEFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSA
MKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDEKRELLKRYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM

Sequence of entity 8 (F, f), FASTA

>7MEI_8 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F, f)
MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQ
HEQIRRKTLKEKAIPKDQRATTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRI
AMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL

Sequence of entity 9 (G, g), FASTA

>7MEI_9 DNA-directed RNA polymerase II subunit RPB7 (chains G, g)
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGR
ILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLT
FNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI

Sequence of entity 10 (H, h), FASTA

>7MEI_10 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H, h)
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIA
SSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGG
LLMRLEGNYRNLNNLKQENAYLLIRR

Sequence of entity 11 (I, i), FASTA

>7MEI_11 DNA-directed RNA polymerase II subunit RPB9 (chains I, i)
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQ
DIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
FS

Sequence of entity 12 (J, j), FASTA

>7MEI_12 DNA-directed RNA polymerases II subunit RPABC5 (chains J, j)
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKF
LRYNPLEKRD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ZN	Zinc ion	Zn	16

Primary citation

Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II. Yang, C., Fujiwara, R., Kim, H.J. et al. Mol Cell (2022) 82:660-676.e9. DOI 10.1016/j.molcel.2021.12.020 · PubMed

Other PDB entries of the same protein (UniProt P04050 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VKO 1.8 Å, SPT6 tSH2-RPB1 1468-1500 pT1471, pS1493
9SV6 1.96 Å, CryoEM structure of transcribing RNA polymerase II elongation complex with ATP and Elf1
5VKL 2.2 Å, SPT6 tSH2-RPB1 1476-1500 pS1493
9W8V 2.23 Å, Structure of post-translocation state of yeast Pol II complexed with a cisplatin-induced…
9QEB 2.26 Å, CryoEM structure of transcribing RNA polymerase II elongation complex
1TWF 2.3 Å, RNA polymerase II complexed with UTP at 2.3 A resolution
9RYB 2.33 Å, CryoEM structure of transcribing RNA polymerase II elongation complex in post-catalysis…
9KD8 2.46 Å, The structure of RNA polymerase II elongation complex paused at N-2 state by actinomycin…
6NPW 2.49 Å, SSu72/Sympk in complex with Ser2/Ser5 phosphorylated peptide
9K7F 2.5 Å, RNA polymerase II elongation complex apo structure.
30ES 2.54 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…
30EP 2.55 Å, Cryo-EM structure of the yeast RNA polymerase II elongation complex with 19-mer RNA in…

Browse structure collections

About this viewer

MolViewer shows 7MEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.