7MEQ: Human TMPRSS2

Crystal structure of human TMPRSS2 in complex with Nafamostat. Determined by X-ray diffraction at 1.95 Å resolution. Released 21 Apr 2021.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,643
Mol. weight: 44.5 kDa
Ligands: GBS
Released: 21 Apr 2021

Explore 7MEQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7MEQ contains 10 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	149-152	4	1
β-strand	157-161	5	1
β-strand	168-170	3	1
β-strand	171	1	2
β-strand	172	1	1
α-helix	178-187	10
β-strand	196-200	5	1
β-strand	209-212	4	2
β-strand	225-228	4	2
β-strand	236-240	5	1
β-strand	257	1	3
β-strand	260-261	2	4
α-helix	262-263	2
β-strand	270-275	6	5
β-strand	278-285	8	5
β-strand	290-293	4	5
α-helix	295-298	4
α-helix	305-307	3
β-strand	308-312	5	5
β-strand	316	1	6
α-helix	317-319	3
β-strand	326-333	8	5
β-strand	338	1	7
β-strand	343	1	7
β-strand	347-351	5	5
α-helix	363-364	2
β-strand	365	1	4
α-helix	366-368	3
β-strand	378-383	6	4
α-helix	391-394	4
β-strand	396	1	6
β-strand	398-405	8	4
α-helix	407-410	4
β-strand	424-428	5	4
β-strand	435	1	3
β-strand	444-449	6	4
β-strand	452-461	10	4
β-strand	472-476	5	4
α-helix	477-490	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transmembrane protease serine 2	A	protein	395	Homo sapiens	O15393 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7MEQ_1 Transmembrane protease serine 2 (chains A)
MGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSW
HPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHS
DACSSKAVVSLRCIACGVNLNDDDDKIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPE
WIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALM
KLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQR
CNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAY
RPGVYGNVMVFTDWIYRQMRADGEFVEHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
GBS	4-carbamimidamidobenzoic acid	C8 H9 N3 O2	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

Structure and activity of human TMPRSS2 protease implicated in SARS-CoV-2 activation. Fraser, B.J., Beldar, S., Seitova, A. et al. Nat Chem Biol (2022) 18:963-971. DOI 10.1038/s41589-022-01059-7 · PubMed

Other PDB entries of the same protein (UniProt O15393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8V04 1.58 Å, High resolution TMPRSS2 structure following acylation by nafamostat
8S0L 1.8 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
9JD1 1.9 Å, Crystal structure of TMPRSS2 in complex with Fab
9JD0 2.0 Å, Crystal structure of TMPRSS2 in complex with nanobody
9U8G 2.0 Å, Crystal structure of TMPRSS2 in complex with nanobody77_10
9E83 2.07 Å, TMPRSS2 crystal structure following acylation by UCSF_157
8V1F 2.19 Å, TMPRSS2 complexed with the noncovalent inhibitor 6-amidino-2-napthol
8S0N 2.3 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
7Y0E 2.39 Å, Crystal structure of TMPRSS2 in complex with Camostat
8HD8 2.4 Å, Crystal structure of TMPRSS2 in complex with 212-148
9IZN 2.4 Å, Crystal structure of HKU1A RBD bound to TMPRSS2
7XYD 2.58 Å, Crystal structure of TMPRSS2 in complex with Nafamostat

Browse structure collections

About this viewer

MolViewer shows 7MEQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.